DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment babos and kirrel1b

DIOPT Version :9

Sequence 1:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster
Sequence 2:XP_017212964.1 Gene:kirrel1b / 100170816 ZFINID:ZDB-GENE-070912-173 Length:801 Species:Danio rerio


Alignment Length:131 Identity:33/131 - (25%)
Similarity:49/131 - (37%) Gaps:27/131 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PNPVASEKINKTLSVTGIRGEDVVLKCDVGSNLHSSDVVVLWYFGDNVISNGKNLVQPNFKLDAN 121
            |.||       |:.|    ..||.|.|....|   ..:.:.|      ...|.::|..|     :
Zfish   318 PRPV-------TVDV----DSDVTLNCKWSGN---PPLTLTW------TKKGSSMVLSN-----S 357

  Fly   122 YDLTILKASPQVAGSYLCK-VLPSGSVVNTKVTIAEHSLDAIAPESSTSAAGSASSFLGCTVLAS 185
            ..|.:...|...||.|:|| ::|...|..|:||:..:....|:.|....|.......:.| .:||
Zfish   358 NQLFLKSVSQADAGQYVCKAIVPRIGVGETEVTLTVNGPPIISSEPIQYAVRGEKGEIKC-YIAS 421

  Fly   186 T 186
            |
Zfish   422 T 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
babosNP_001286719.1 ig 70..154 CDD:278476 21/84 (25%)
IG_like 70..154 CDD:214653 21/84 (25%)
kirrel1bXP_017212964.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.