DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment babos and lrit3b

DIOPT Version :9

Sequence 1:	NP_001286719.1	Gene:	babos / 37557	FlyBaseID:	FBgn0034724	Length:	196	Species:	Drosophila melanogaster
Sequence 2:	XP_009305418.1	Gene:	lrit3b / 100144406	ZFINID:	ZDB-GENE-070424-130	Length:	487	Species:	Danio rerio

Alignment Length:	137	Identity:	38/137 - (27%)
Similarity:	56/137 - (40%)	Gaps:	39/137 - (28%)

- Green bases have known domain annotations that are detailed below.

  Fly    69 LSVTGIRGEDVVLKCDVGSNLHS---SDVVVLWYFGDNVISNGKNLVQPNFKLDANYDLTILKAS 130
            |:|..:|.   |...|:.||..|   :|:..||.|.|:      |..|.:|.|.       |:.:
Zfish   178 LAVRYLRN---VTYLDLSSNRLSTLANDLTALWLFSDS------NQTQRSFVLG-------LQDN 226

  Fly   131 PQVAGSYLCKVL-----PSGSVV--NTKVTIAEHSLD-AIAPESS-----------TSAAGSASS 176
            |.|....|..:|     |..|:|  :..:|.:| .|| |..|..|           .::|...::
Zfish   227 PWVCDCRLSTLLDISRGPESSLVLLDRFLTCSE-PLDLAGVPFQSVELSRCRRPYVVTSATKITA 290

  Fly   177 FLGCTVL 183
            .||.|||
Zfish   291 LLGSTVL 297

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
babos	NP_001286719.1	ig	70..154	CDD:278476	24/93 (26%)
babos	NP_001286719.1	IG_like	70..154	CDD:214653	24/93 (26%)
lrit3b	XP_009305418.1	LRRNT	51..92	CDD:214470
		leucine-rich repeat	69..89	CDD:275380
		LRR_8	112..172	CDD:290566
		leucine-rich repeat	114..137	CDD:275378
		leucine-rich repeat	138..161	CDD:275378
		LRR_8	160..214	CDD:290566	13/44 (30%)
		LRR_4	160..201	CDD:289563	8/25 (32%)
		leucine-rich repeat	162..185	CDD:275378	2/6 (33%)
		leucine-rich repeat	186..199	CDD:275378	5/12 (42%)
		leucine-rich repeat	215..230	CDD:275378	5/21 (24%)
		Ig	278..391	CDD:299845	6/20 (30%)
		I-set	279..391	CDD:254352	6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3510
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900