DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and IL18RAP

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001380415.1 Gene:IL18RAP / 8807 HGNCID:5989 Length:599 Species:Homo sapiens


Alignment Length:432 Identity:85/432 - (19%)
Similarity:147/432 - (34%) Gaps:151/432 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 DDVILNCDA----------RN------------FQLSN---AVVWYKNRIIIANGQ--NPISQRV 122
            ::.:|.||.          ||            |..||   .|.||:..   :||.  ..|.:..
Human    40 EEFVLFCDLPEPQKSHFCHRNRLSPKQVPEHLPFMGSNDLSDVQWYQQP---SNGDPLEDIRKSY 101

  Fly   123 QCMLNNSILLRNVSP--EDSDDYYC-------------------EILPQRVR--QHTA-----LR 159
            ..::.:...|..::|  .:|..|.|                   |:.||...  :::|     |.
Human   102 PHIIQDKCTLHFLTPGVNNSGSYICRPKMIKSPYDVACCVKMILEVKPQTNASCEYSASHKQDLL 166

  Fly   160 VGARLSILCDDRDITDRSQTFRQGDHHKLECRTYLPDNATIKWSFNDLNGQPSSVDNQNGVIILD 224
            :|:..||.|.                 .|.|::.....| :.|.   .||:..||:..|.::: |
Human   167 LGSTGSISCP-----------------SLSCQSDAQSPA-VTWY---KNGKLLSVERSNRIVV-D 209

  Fly   225 NVDEKNAGDYQC---LADDGSRHPPHGTVHI-----DVQYSP-IVSTHRHNVNTEKGATAELYCN 280
            .|.:.:.|.|.|   .:|..|.......|.:     |.:..| |:......:..|.|....:.|.
Human   210 EVYDYHQGTYVCDYTQSDTVSSWTVRAVVQVRTIVGDTKLKPDILDPVEDTLEVELGKPLTISCK 274

  Fly   281 YR------AKPIGRSYFIKDGK---TLQLSDKYSLKDSVHNDHNRTTLIVREVTDSDL-GEYLCQ 335
            .|      ..|:.: ::|||..   .:.:.:..|:|.::.::.....:|:.:||..|| .:::|.
Human   275 ARFGFERVFNPVIK-WYIKDSDLEWEVSVPEAKSIKSTLKDEIIERNIILEKVTQRDLRRKFVCF 338

  Fly   336 VENAIGSNEVKVHVSYNPETPQFEDMTVEGNKVTL-----------------------HW----- 372
            |:|:||:....|.:.             |...|.|                       ||     
Human   339 VQNSIGNTTQSVQLK-------------EKRGVVLLYILLGTIGTLVAVLAASALLYRHWIEIVL 390

  Fly   373 LVRSHQLLSEAM---LDYQLTGSYT-WS------TVQVLETH 404
            |.|::|...:.:   .|:....||. ||      |..:.|.|
Human   391 LYRTYQSKDQTLGDKKDFDAFVSYAKWSSFPSEATSSLSEEH 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 19/108 (18%)
IGc2 83..146 CDD:197706 19/108 (18%)
IG_like 176..254 CDD:214653 17/85 (20%)
Ig 176..239 CDD:299845 14/65 (22%)
I-set 258..349 CDD:254352 23/101 (23%)
Ig 275..348 CDD:143165 18/82 (22%)
IL18RAPNP_001380415.1 Ig_6 100..155 CDD:408247 8/54 (15%)
Ig 162..>221 CDD:416386 18/80 (23%)
Ig strand A 162..166 CDD:409353 0/3 (0%)
Ig strand B 171..175 CDD:409353 2/3 (67%)
Ig strand C 188..193 CDD:409353 2/8 (25%)
Ig strand C' 196..198 CDD:409353 0/1 (0%)
Ig strand E 204..209 CDD:409353 1/5 (20%)
Ig 251..354 CDD:416386 23/116 (20%)
Ig strand A 251..254 CDD:409353 1/2 (50%)
Ig strand A' 262..265 CDD:409353 0/2 (0%)
Ig strand B 267..276 CDD:409353 1/8 (13%)
Ig strand C 285..290 CDD:409353 1/5 (20%)
Ig strand D 300..308 CDD:409353 0/7 (0%)
Ig strand E 315..323 CDD:409353 0/7 (0%)
Ig strand F 334..340 CDD:409353 1/5 (20%)
Ig strand G 344..350 CDD:409353 1/5 (20%)
TIR 419..559 CDD:396246 3/14 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.