DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and DIP-epsilon

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001137799.1 Gene:DIP-epsilon / 7354433 FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster


Alignment Length:320 Identity:76/320 - (23%)
Similarity:132/320 - (41%) Gaps:31/320 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 TKNHAEQEAPPYFDVTDLRVEAKPGDDVILNCDARNFQLSNAVVW--YKNRIIIANGQNPISQRV 122
            |.|:...|.|.:.||.: .:....|.:|.|.|..:|.. |..|.|  ::...|:....:.|::..
  Fly    43 TLNNVISEDPEFTDVIE-NITVPAGRNVKLACSVKNLG-SYKVAWMHFEQSAILTVHNHVITRNP 105

  Fly   123 QCMLNNS---------ILLRNVSPEDSDDYYCEILPQRVR-QHTALRVGARLSILCDDRDITDRS 177
            :..:.:.         :.:.||..||...|.|:|.....: |:..::|....:|   |..:|...
  Fly   106 RISVTHDKHDKHRTWFLHINNVQEEDRGRYMCQINTVTAKTQYGFVKVVVPPNI---DDALTSSD 167

  Fly   178 QTFRQGDHHKLECRTYLPDNATIKWSFND-----LNGQPSSVDNQNGVIILDNVDEKNAGDYQCL 237
            ...|:||:..|.|:.......||||..:|     :|......|.:...:.|:.:...:.|.|.|:
  Fly   168 IIVREGDNVTLRCKAKGSPEPTIKWKRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCI 232

  Fly   238 ADDGSRHPPHGT--VHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDG-KTLQ 299
            |.:|.  ||..:  :.:.|.:||:|......|....|....|.|...|.|...:|:.::. :.:.
  Fly   233 ASNGV--PPSVSKRIKVSVDFSPMVWIPHQLVGIPIGFNITLECFIEANPTSLNYWTRENDQMIT 295

  Fly   300 LSDKYSLKDSVHNDHNRTT--LIVREVTDSDLGEYLCQVENAIG--SNEVKVHVSYNPET 355
            .|.||..:....:...:.|  |.:..|..||.|.|.|..:|..|  ...:|:::|..|.|
  Fly   296 ESSKYKTETIPGHPSYKATMRLTITNVQSSDYGNYKCVAKNPRGDMDGNIKLYMSSPPTT 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 15/77 (19%)
IGc2 83..146 CDD:197706 15/73 (21%)
IG_like 176..254 CDD:214653 20/84 (24%)
Ig 176..239 CDD:299845 16/67 (24%)
I-set 258..349 CDD:254352 23/95 (24%)
Ig 275..348 CDD:143165 19/77 (25%)
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 19/97 (20%)
Ig 69..139 CDD:143165 15/70 (21%)
IG_like 165..249 CDD:214653 20/85 (24%)
IGc2 172..237 CDD:197706 16/64 (25%)
IG_like 267..348 CDD:214653 20/80 (25%)
Ig 270..339 CDD:299845 17/68 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442839
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.