DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and il1rapl1a

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_021334418.1 Gene:il1rapl1a / 568868 ZFINID:ZDB-GENE-061013-249 Length:1520 Species:Danio rerio


Alignment Length:312 Identity:65/312 - (20%)
Similarity:106/312 - (33%) Gaps:95/312 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 RVEAKPGD----DVILNCDARNFQ--LSNAVVWYKNRIIIANGQNPISQRVQCMLNNSILLRNVS 136
            |:...|.|    .|:.|.|..::.  :.:.:...||.:.||...:.:.||.|....|        
Zfish  1221 RIPRLPVDIMFNQVLDNPDIADYDSYVKSLLCCLKNAMDIAQKHSSVEQRHQANQYN-------- 1277

  Fly   137 PEDSDDYYCEILPQRVRQHTALRVGARLSI----------LCDD--------------------R 171
                         :||| .|.|.||.|:.:          |.|.                    |
Zfish  1278 -------------KRVR-GTHLSVGDRVLVANKSERGKRKLADKWEDGVFTVVEVNPDIHVYRIR 1328

  Fly   172 DITDRSQTFRQGDHHKLECR-TYLPDNATIKWSFNDLNGQPSSV--DNQNG----------VIIL 223
            |.:.|::..    |..|... .:||.....|......|.||..:  .:|||          .:..
Zfish  1329 DASGRTKVV----HRNLLLEVNFLPIVGIDKEQSTSENNQPLIIVESDQNGADQDSSEDLSAVSF 1389

  Fly   224 DNVDEKNAGDYQ-----CLADDGSRHP-PHGTVHIDVQYS---PIVSTHRHNVNTEKGATAELYC 279
            .....:::.||.     |.:|   |:| .|.|:.:|::.|   ..|.|...:::...||..||..
Zfish  1390 TESSIQSSSDYPYPLPVCESD---RNPVVHVTLPVDLENSHDLDEVDTVDADIHQSPGAANELPT 1451

  Fly   280 NYRAKPIGR--SYFIKDGKTLQLSDKYSLKDSVHND-----HNRTTLIVREV 324
            |.:.:....  :.::.....|..||. ||:.:.:.|     ..|...||:.|
Zfish  1452 NEKHEQDSNEIAQYLPGSPDLLCSDP-SLRGAENADLVKPVRTRVGRIVKSV 1502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 13/72 (18%)
IGc2 83..146 CDD:197706 13/68 (19%)
IG_like 176..254 CDD:214653 20/96 (21%)
Ig 176..239 CDD:299845 15/80 (19%)
I-set 258..349 CDD:254352 17/74 (23%)
Ig 275..348 CDD:143165 13/57 (23%)
il1rapl1aXP_021334418.1 retropepsin_like 46..137 CDD:133136
RT_LTR 403..579 CDD:238825
RNase_HI_RT_Ty3 701..823 CDD:260006
rve 1068..1176 CDD:307008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.