DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and paplna

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_005169942.1 Gene:paplna / 562930 ZFINID:ZDB-GENE-070815-4 Length:1187 Species:Danio rerio


Alignment Length:244 Identity:58/244 - (23%)
Similarity:103/244 - (42%) Gaps:32/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SLLIGQLYVSCAGSPIDADVKGTDYQDDEYEY----GDDTDDDDTQIIDVTKNHAEQEAPPY-FD 73
            |||:|.:.:..:|..:....: .|.:|..|.|    |...::.....:|.::::..|.:..: .|
Zfish   887 SLLVGPITLQDSGWFLCVATR-DDKRDHRYIYLSVSGSSQNNAGISEVDSSQSYTSQSSSRFNID 950

  Fly    74 VTDLRVEAKPGDDVILNCDARNFQLSNAVVWYKNRIIIANGQNPISQRVQCMLNNSILLRNVSPE 138
            .:.| |||:.|....|.|........:||..:.:|.    ||...|.|.....:.:::::.::.:
Zfish   951 YSPL-VEARAGQTAKLQCSVLPVSAIHAVTIHWSRA----GQPLNSLRHSQHSDGTLVIKQLTAD 1010

  Fly   139 DSDDYYCEILPQR--VRQHTALRV--GARLSILCDDRDITDRSQTFRQGDHHKLECRTYLPDNAT 199
            ||..|.|.:...:  ..:...|||  ..|::....|.|:.       ||...:|.| ....:|..
Zfish  1011 DSGLYTCTVTDAQKFEERQVQLRVLGDLRITKAPIDVDVV-------QGSTAQLAC-VVTGENVN 1067

  Fly   200 IKWSFNDLNGQPSSVD------NQNGVIILDNVDEKNAGDYQCLADDGS 242
            :.||   .||.|...|      :.:|.:||:||...:.|.|.|.|..|:
Zfish  1068 VGWS---RNGVPVRPDGHRVHVSADGTLILNNVQSVDEGTYTCNAYTGT 1113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 16/66 (24%)
IGc2 83..146 CDD:197706 13/62 (21%)
IG_like 176..254 CDD:214653 21/73 (29%)
Ig 176..239 CDD:299845 19/68 (28%)
I-set 258..349 CDD:254352
Ig 275..348 CDD:143165
paplnaXP_005169942.1 TSP1 24..75 CDD:214559
ADAM_spacer1 181..293 CDD:310520
TSP1 303..356 CDD:214559
TSP1 388..442 CDD:214559
TSP1 449..498 CDD:214559
TSP1 504..557 CDD:214559
KU 720..771 CDD:238057
Ig_3 839..906 CDD:316449 5/18 (28%)
IGc2 960..1022 CDD:197706 14/65 (22%)
I-set 1039..1121 CDD:333254 24/86 (28%)
PLAC 1142..1173 CDD:312271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.