DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and igsf9a

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_005155702.1 Gene:igsf9a / 557459 ZFINID:ZDB-GENE-060503-288 Length:1619 Species:Danio rerio


Alignment Length:467 Identity:100/467 - (21%)
Similarity:166/467 - (35%) Gaps:130/467 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 APPYF-DVTDLRVEAKPGDDVILNCDARNFQLSNAVVWYKNRIIIANGQNPIS-QRVQCMLNNSI 130
            |||.. :.:...||...|..:.|.|.|:. .....:.|.|:..       ||. |....|:|.|:
Zfish   134 APPVLTETSPPEVEVFVGRSLTLKCAAQG-NPRPTITWSKDGA-------PIKPQHKVKMVNGSV 190

  Fly   131 LLRNVSPEDSDDYYCEILPQRVRQHTALRVG-----ARLSILCDDRDITDRSQT-FRQGDHHKLE 189
            ....||.|.:..|.|         :|:...|     .||.|:.....|...|.| .......||:
Zfish   191 SFHAVSREAAGQYQC---------YTSNSEGNATHVTRLKIIGPPVIIIPPSDTVLNMSQDAKLK 246

  Fly   190 CRTYL-PDNATIKWSFNDLNGQPSSVDNQ-------------NGVIILDNVDEKNAGDYQCLADD 240
            |:... |.|.|..|       |...||..             :|.:::..:..:::|:|.|:..:
Zfish   247 CQAEADPPNMTYVW-------QRQGVDIYHIDSLKSRIKVIVDGTLLISRLAPEDSGNYTCMPTN 304

  Fly   241 GSRHPPHGTVHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAK-PIGRSYFIKDGKTLQLS--D 302
            |....|..:..:.||:...|...........|....:.|..||: |:....:|||||.|.|.  .
Zfish   305 GLPVSPSASAVLTVQHPAQVIQMPKLTFLPTGMRGAIVCPVRAEPPLSHIDWIKDGKPLDLGMYP 369

  Fly   303 KYSLKDSVHNDHNRTTLIVREVTDSDLGEYLCQVENAIGS---NEVKVHVSYNPETPQF------ 358
            .::|...       .::::..|.|...|.|:|...|:.|:   :|....:..:|  |.|      
Zfish   370 GWTLASD-------GSIVIATVNDDAAGVYICTPYNSFGTTGQSEPTTVILQDP--PSFKVSPRN 425

  Fly   359 ---EDM-------------------------------TVEGN-KVTLHWLVRSHQLLSEAMLDYQ 388
               :|:                               |:.|| .:.||.|.:.||      .:::
Zfish   426 EYRQDVGTMLVIPCQMVGNPAPKVNWRKIGAATRSLFTLAGNGSLILHPLSKDHQ------GEWE 484

  Fly   389 LTGSYTWSTVQ------VLETHRHN-NTDNIWKITHQLELS--RG----------VWHARV---K 431
            .:.|...:||.      ||.|..|. ::.::...|:|..:|  .|          ||:.:|   :
Zfish   485 CSSSNRVATVSIKTMVLVLGTSPHAVSSVSVIPGTNQANVSWVAGFDGGYTQTFTVWYKQVSAGR 549

  Fly   432 TKNTKGWSHFSN 443
            |:..:.|..||:
Zfish   550 TEEKQEWLSFSD 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 18/67 (27%)
IGc2 83..146 CDD:197706 16/63 (25%)
IG_like 176..254 CDD:214653 18/92 (20%)
Ig 176..239 CDD:299845 16/77 (21%)
I-set 258..349 CDD:254352 22/96 (23%)
Ig 275..348 CDD:143165 20/78 (26%)
igsf9aXP_005155702.1 IG_like 27..110 CDD:214653
Ig 35..111 CDD:299845
I-set 140..221 CDD:254352 22/97 (23%)
IGc2 151..212 CDD:197706 18/77 (23%)
Ig 233..318 CDD:299845 18/91 (20%)
I-set 233..318 CDD:254352 18/91 (20%)
Ig <349..402 CDD:299845 15/59 (25%)
IG_like 423..502 CDD:214653 12/84 (14%)
Ig 435..498 CDD:143165 11/68 (16%)
FN3 507..602 CDD:238020 12/55 (22%)
fn3 614..696 CDD:278470
PHA02666 1105..>1312 CDD:222914
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.