DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and lrit1a

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001018174.2 Gene:lrit1a / 553943 ZFINID:ZDB-GENE-040924-5 Length:643 Species:Danio rerio


Alignment Length:511 Identity:93/511 - (18%)
Similarity:163/511 - (31%) Gaps:195/511 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 DARNFQLSN----AVVWYKNRIIIANGQNPISQRVQCMLNNSILLRNVSPEDSDDYYCEILPQRV 152
            |..|.|||:    |.::.||...:.            :.:|::|   ..|.:..:.:..|.|...
Zfish   137 DIHNNQLSSLPSEAALYMKNITYLD------------LSSNNLL---TVPAEVLNTWLTIKPTLG 186

  Fly   153 RQHTALRVGARLS-ILCDDRDITDRSQTFRQGDHHKLECRTY----LPDNATIKWSFNDLNGQPS 212
            .:.:.|.:|...: .|||                    ||.|    ...:.::..:|.|...:.:
Zfish   187 AESSKLILGLHDNPWLCD--------------------CRLYDLVQFQKSPSLSVAFIDTRLRCA 231

  Fly   213 SVDNQNGVIILDNVDEKNAGDYQCLADDGSRHPPHGTVHIDVQYSPIVSTHRHNVNTEKGATAEL 277
            ..::.:||:..|....:..|                         |.|.|....|.:..|....|
Zfish   232 DPESLSGVLFSDAELRRCQG-------------------------PRVHTAVARVRSAVGNNVLL 271

  Fly   278 YCNYRAKPIGR-SYFIKDGKTLQLSDKYSLKDSVHNDHNRTTLI-------------VREVTDSD 328
            .|.....||.. ::...|||.|                |.|.|:             |..|:..|
Zfish   272 RCGTVGVPIPELAWRRADGKPL----------------NGTVLLENSKEGIVWSILSVPAVSYRD 320

  Fly   329 LGEYLCQVENAIGSNEVKVHVSYNPETPQFEDMTVEGNKVTLHWLVRSHQLLSEAMLDYQ----- 388
            .|:|:|:..|..||.|..:.:..| :.|:.|:.|::...     .::|.:..:.....||     
Zfish   321 TGKYICKATNYAGSAEAVISLIIN-DAPKMENPTLDPKP-----KLKSKKPNTMVKAAYQEKHIA 379

  Fly   389 ------------------LTGSY----------------TWSTVQVLETHRHN---NTDNIWKIT 416
                              .||.|                |.|....|||:..|   ||.::.:..
Zfish   380 TYVSPTPKNGLPLSGTVSYTGPYPGMESDNAANSRMNTQTASPDGFLETNLSNLAANTSSLQQDP 444

  Fly   417 HQLELSRGV-----------WHARVKTKNTKGWSHFSNDHVFEIPEDSEVDKDEEVELPP--DEI 468
            .::..|..|           |.|.. .|||..:|     .::.:..:.::   ..:.:.|  :.|
Zfish   445 DRVVRSVKVIGDTDYTVCLNWRAPT-AKNTTAFS-----VLYAVFGERDM---RRINVSPGNNRI 500

  Fly   469 VQAGIMPMSK-------------------------GAASSMQRL-NVGVILLAALL 498
            |..|::|.:|                         .:|:..|:| ||.||.:|.::
Zfish   501 VIEGLVPKTKYIACVCVKGLIPKKEQCVIFSTDAAASANGTQKLINVVVITVACVI 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 11/57 (19%)
IGc2 83..146 CDD:197706 11/57 (19%)
IG_like 176..254 CDD:214653 9/81 (11%)
Ig 176..239 CDD:299845 9/66 (14%)
I-set 258..349 CDD:254352 26/104 (25%)
Ig 275..348 CDD:143165 21/86 (24%)
lrit1aNP_001018174.2 leucine-rich repeat 61..84 CDD:275378
LRR_8 63..119 CDD:290566
LRR_RI <77..175 CDD:238064 11/52 (21%)
leucine-rich repeat 85..108 CDD:275378
LRR_8 108..167 CDD:290566 9/41 (22%)
leucine-rich repeat 109..132 CDD:275378
leucine-rich repeat 133..156 CDD:275378 6/18 (33%)
leucine-rich repeat 157..170 CDD:275378 2/27 (7%)
LRRCT 199..243 CDD:214507 10/63 (16%)
I-set 252..343 CDD:254352 26/106 (25%)
Ig 259..333 CDD:299845 20/89 (22%)
fn3 448..515 CDD:278470 14/75 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.