DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and KIRREL1

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:391 Identity:88/391 - (22%)
Similarity:136/391 - (34%) Gaps:94/391 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TDLRVEAKPGDD-------VILNCDARNFQLSNAVVWYKNRIIIANGQN----PISQRVQCMLNN 128
            |..|...:|.|.       .:|.|...|:  |..|.|.|:.:.:..||.    |..:.|......
Human    19 TQTRFSQEPADQTVVAGQRAVLPCVLLNY--SGIVQWTKDGLALGMGQGLKAWPRYRVVGSADAG 81

  Fly   129 SILLRNVSPEDSDD--YYCEILPQRVRQHTALRVGARLSILCDDRDI-TDRSQT--FRQGDHHKL 188
            ...|.....|.|||  |.|:.....:|...     |:|::|....|. .|....  .:.|..|.|
Human    82 QYNLEITDAELSDDASYECQATEAALRSRR-----AKLTVLIPPEDTRIDGGPVILLQAGTPHNL 141

  Fly   189 ECRTY-LPDNATIKWSFNDLNGQPSSV-------DNQNGVII---LDNVDEKNAGD-YQCLADDG 241
            .||.: ....|||.| |.|...|..:|       |.:....:   |.|..:.:.|. :.|.:.:.
Human   142 TCRAFNAKPAATIIW-FRDGTQQEGAVASTELLKDGKRETTVSQLLINPTDLDIGRVFTCRSMNE 205

  Fly   242 SRHPPHG---TVHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDK 303
            :  .|.|   ::.:||.:.|.|:........::|......|...|.|....|....|..| :.|.
Human   206 A--IPSGKETSIELDVHHPPTVTLSIEPQTVQEGERVVFTCQATANPEILGYRWAKGGFL-IEDA 267

  Fly   304 YSLKDSVHNDHNRTTLIVREVTDSDLGEYLCQVENAIGSNEVK--VHVSYNPE---------TPQ 357
            :..:...:.|::..|..|.           |:|.|.:||..|.  |:|.:.|.         |..
Human   268 HESRYETNVDYSFFTEPVS-----------CEVHNKVGSTNVSTLVNVHFAPRIVVDPKPTTTDI 321

  Fly   358 FEDMTVE----GN-KVTLHW------------------------LVRSHQLLSEAMLDYQLTGSY 393
            ..|:|:.    || .:||.|                        |..|:|||.:::.... .|:|
Human   322 GSDVTLTCVWVGNPPLTLTWTKKDSNMGPRPPGSPPEAALSAQVLSNSNQLLLKSVTQAD-AGTY 385

  Fly   394 T 394
            |
Human   386 T 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 19/79 (24%)
IGc2 83..146 CDD:197706 19/75 (25%)
IG_like 176..254 CDD:214653 20/94 (21%)
Ig 176..239 CDD:299845 18/76 (24%)
I-set 258..349 CDD:254352 20/92 (22%)
Ig 275..348 CDD:143165 16/74 (22%)
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352 24/100 (24%)
Ig 25..116 CDD:299845 23/97 (24%)
Ig2_KIRREL3-like 138..219 CDD:143236 19/83 (23%)
I-set 223..304 CDD:254352 20/92 (22%)
Ig_2 227..305 CDD:290606 18/89 (20%)
Ig_2 311..405 CDD:290606 16/77 (21%)
IG_like 314..405 CDD:214653 16/74 (22%)
Ig5_KIRREL3 407..504 CDD:143306
IG_like 416..504 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.