DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and iglon5

DIOPT Version :10

Sequence 1:NP_611666.2 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:277 Identity:65/277 - (23%)
Similarity:110/277 - (39%) Gaps:34/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 GDDVILNCDARNFQLSNAV---VWYKNRIIIANGQN--PISQRVQCMLNN----SILLRNVSPED 139
            |:.|:|.|     ::...|   .|.....|:..|.:  .:..||....||    ||.:..|...|
Zfish    41 GESVVLRC-----KIDEEVTHKAWLNRSNILFTGTDKWSLDSRVSLENNNNSDFSIRIERVMVAD 100

  Fly   140 SDDYYCEI----LPQRVRQHTALRVGARLSILCDDRDITDRSQTFRQGDHHKLECRTYLPDNATI 200
            ...|.|..    .|:....:..::|.||:..:..|:.:       .:|:...|.|........||
Zfish   101 EGPYTCSFQARNKPRTAHVYLIVQVPARIVNISQDKSV-------NEGEDVNLFCLAVGRPEPTI 158

  Fly   201 KWSFNDLNGQPSSVDNQNGVIILDNVDEKNAGDYQCLADDGSRHPPHGTVHIDVQYSPIVSTHRH 265
            .|  .|..   ..:.|:...:.:..:....|.|::|:.::|...|....|.:.|.|.||: |...
Zfish   159 TW--KDFK---YGLLNEGEFLEITEIKRHQAEDFECITNNGVAPPDTRKVKVTV
NYPPII-TDVK 217

  Fly   266 NVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSLKDSVHNDHNRTTLIVREVTDSDLG 330
            |:..:.|.||.|.|...|.|.....:.:|.:....||. :||  :.|:..|:.|:...||:...|
Zfish   218 NMPAQVGKTAILRCEAMAVPTASFEWYRDDRRPVESDN-TLK--IKNEKTRSLLLFTNVTEKHFG 279

  Fly   331 EYLCQVENAIGSNEVKV 347
            .|.|...|.:|::...:
Zfish   280 NYTCFASNRLGASNASM 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_611666.2 Ig_3 69..146 CDD:464046 17/70 (24%)
Ig_3 173..238 CDD:464046 11/64 (17%)
Ig 258..349 CDD:472250 26/90 (29%)
Ig strand B 275..279 CDD:409353 2/3 (67%)
Ig strand C 288..292 CDD:409353 0/3 (0%)
Ig strand E 317..321 CDD:409353 1/3 (33%)
Ig strand F 331..336 CDD:409353 2/4 (50%)
iglon5NP_001017775.2 Ig 35..123 CDD:472250 19/86 (22%)
Ig strand B 44..48 CDD:409353 2/3 (67%)
Ig strand C 56..60 CDD:409353 0/3 (0%)
Ig strand E 89..93 CDD:409353 2/3 (67%)
Ig strand F 103..108 CDD:409353 2/4 (50%)
Ig strand G 116..119 CDD:409353 0/2 (0%)
Ig 122..207 CDD:472250 18/96 (19%)
Ig strand B 144..148 CDD:409353 1/3 (33%)
Ig strand C 157..161 CDD:409353 3/5 (60%)
Ig strand E 172..176 CDD:409353 0/3 (0%)
Ig strand F 186..191 CDD:409353 2/4 (50%)
Ig strand G 200..203 CDD:409353 0/2 (0%)
Ig_3 210..287 CDD:464046 24/80 (30%)

Return to query results.
Submit another query.