DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and iglon5

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:277 Identity:65/277 - (23%)
Similarity:110/277 - (39%) Gaps:34/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 GDDVILNCDARNFQLSNAV---VWYKNRIIIANGQN--PISQRVQCMLNN----SILLRNVSPED 139
            |:.|:|.|     ::...|   .|.....|:..|.:  .:..||....||    ||.:..|...|
Zfish    41 GESVVLRC-----KIDEEVTHKAWLNRSNILFTGTDKWSLDSRVSLENNNNSDFSIRIERVMVAD 100

  Fly   140 SDDYYCEI----LPQRVRQHTALRVGARLSILCDDRDITDRSQTFRQGDHHKLECRTYLPDNATI 200
            ...|.|..    .|:....:..::|.||:..:..|:.:       .:|:...|.|........||
Zfish   101 EGPYTCSFQARNKPRTAHVYLIV
QVPARIVNISQDKSV-------NEGEDVNLFCLAVGRPEPTI 158

  Fly   201 KWSFNDLNGQPSSVDNQNGVIILDNVDEKNAGDYQCLADDGSRHPPHGTVHIDVQYSPIVSTHRH 265
            .|  .|..   ..:.|:...:.:..:....|.|::|:.::|...|....|.:.|.|.||: |...
Zfish   159 TW--KDFK---YGLLNEGEFLEITEIKRHQAEDFECITNNGVAPPDTRKVKVTV
NYPPII-TDVK 217

  Fly   266 NVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSLKDSVHNDHNRTTLIVREVTDSDLG 330
            |:..:.|.||.|.|...|.|.....:.:|.:....||. :||  :.|:..|:.|:...||:...|
Zfish   218 NMPAQVGKTAILRCEAMAVPTASFEWYRDDRRPVESDN-TLK--IKNEKTRSLLLFTNVTEKHFG 279

  Fly   331 EYLCQVENAIGSNEVKV 347
            .|.|...|.:|::...:
Zfish   280 NYTCFASNRLGASNASM 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 17/70 (24%)
IGc2 83..146 CDD:197706 17/70 (24%)
IG_like 176..254 CDD:214653 14/77 (18%)
Ig 176..239 CDD:299845 11/62 (18%)
I-set 258..349 CDD:254352 26/90 (29%)
Ig 275..348 CDD:143165 20/73 (27%)
iglon5NP_001017775.2 IG_like 33..123 CDD:214653 19/86 (22%)
Ig 35..123 CDD:299845 19/86 (22%)
Ig 125..>183 CDD:299845 12/69 (17%)
I-set 128..207 CDD:254352 16/90 (18%)
IG_like 217..298 CDD:214653 23/83 (28%)
ig 223..296 CDD:278476 22/75 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576336
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.