DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and dpr6

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001287018.1 Gene:dpr6 / 50296 FlyBaseID:FBgn0040823 Length:396 Species:Drosophila melanogaster


Alignment Length:294 Identity:61/294 - (20%)
Similarity:108/294 - (36%) Gaps:87/294 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 PEDSDDYYCEILPQRVRQHTALRVGARLSILCDDRDITDRSQTF-RQGDHHKLECRTYLPDNATI 200
            |:..:.|:....|:.|   ||| :|....:.|..|::.:::.:: |..|.|.|...:|   ..|.
  Fly    68 PKWMEPYFDPSTPRNV---TAL-MGKSAYLSCRVRNLANKTVSWIRHRDIHILTVGSY---TYTS 125

  Fly   201 KWSFNDLNGQPSSVDNQNGVIILDNVDEKNAGDYQCLADDGSRHPPHG-TVHIDVQYSPIVSTHR 264
            ...|...:.|    |.::..:.:....:::||.|:|..   |..|... .|.::|..........
  Fly   126 DQRFQATHHQ----DTEDWTLQIKWAQKRDAGMYECQI---STQPVRSYFVRLNVVVPTATILGG 183

  Fly   265 HNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSLKDSVHNDHNR------------T 317
            .:::.:||:|..|.|..:..|...:|..          .|..::.::.|.:|            |
  Fly   184 PDLHVDKGSTINLTCTVKFSPEPPAYIF----------WYHHEEVINYDSSRGGVSVITEKGDVT 238

  Fly   318 T--LIVREVTDSDLGEYLCQVENA-IGSNEVKVHV--------SYNPETPQFEDMTVEGNKVTLH 371
            |  |:::....:|.|:|.|...|| :.|  |:|||        ..:||..|              
  Fly   239 TSFLLIQNADLADSGKYSCAPSNADVAS--VRVHVLNVRAIISGEHPEAMQ-------------- 287

  Fly   372 WLVRSHQLLSEAMLDYQLTGS----YTWSTVQVL 401
                              |||    |.|.|:.:|
  Fly   288 ------------------TGSSGCQYNWLTIVLL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 2/8 (25%)
IGc2 83..146 CDD:197706 2/8 (25%)
IG_like 176..254 CDD:214653 16/79 (20%)
Ig 176..239 CDD:299845 13/63 (21%)
I-set 258..349 CDD:254352 22/105 (21%)
Ig 275..348 CDD:143165 18/87 (21%)
dpr6NP_001287018.1 V-set 79..174 CDD:284989 24/108 (22%)
IG_like 80..175 CDD:214653 25/108 (23%)
IG_like 184..271 CDD:214653 22/98 (22%)
IGc2 191..262 CDD:197706 16/80 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.