DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and OPCML

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001306032.1 Gene:OPCML / 4978 HGNCID:8143 Length:354 Species:Homo sapiens


Alignment Length:289 Identity:66/289 - (22%)
Similarity:104/289 - (35%) Gaps:44/289 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VEAKPGDDVILNC--DARNFQLSNAVVWYKNRIIIANGQN--PISQRVQCMLNN----SILLRNV 135
            |..:.|:...|.|  |.|    ...|.|.....|:..|.:  .|..||..::|.    ||:::||
Human    45 VTVRQGESATLRCTIDDR----VTRVAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNV 105

  Fly   136 SPEDSDDYYCEIL----PQRVRQHTALRVGARLSILCDDRDITDRSQTFRQGDHHKLECRTYLPD 196
            ...|...|.|.:.    |:..|.|..::|..::..:..|       .|..:|....|.|......
Human   106 DVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSD-------ITVNEGSSVTLLCLAIGRP 163

  Fly   197 NATIKWSFNDLNGQPSSVDNQNGVIILD------NVDEKNAGDYQCLADDGSRHPPHGTVHIDVQ 255
            ..|:.|       :..||....|.:..|      ::....:|:|:|.|.:....|....|.|.|.
Human   164 EPTVTW-------RHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVN 221

  Fly   256 YSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSLKDS--VHNDHNRTT 318
            |.|.:|..: |.....|....|.|...|.|:....:.|:...|...     .|.  :.|....:|
Human   222 YPPYISKAK-NTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATG-----LDGMRIENKGRMST 280

  Fly   319 LIVREVTDSDLGEYLCQVENAIGSNEVKV 347
            |....|::.|.|.|.|...|.:|:....:
Human   281 LTFFNVSEKDYGNYTCVATNKLGNTNASI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 20/74 (27%)
IGc2 83..146 CDD:197706 19/70 (27%)
IG_like 176..254 CDD:214653 17/83 (20%)
Ig 176..239 CDD:299845 13/68 (19%)
I-set 258..349 CDD:254352 21/92 (23%)
Ig 275..348 CDD:143165 17/75 (23%)
OPCMLNP_001306032.1 Ig 44..132 CDD:416386 24/90 (27%)
Ig strand A' 44..49 CDD:409353 1/3 (33%)
Ig strand B 51..59 CDD:409353 2/7 (29%)
CDR1 59..63 CDD:409353 2/7 (29%)
FR2 64..70 CDD:409353 2/5 (40%)
Ig strand C 64..70 CDD:409353 2/5 (40%)
CDR2 71..83 CDD:409353 2/11 (18%)
Ig strand C' 72..76 CDD:409353 1/3 (33%)
Ig strand C' 80..83 CDD:409353 0/2 (0%)
FR3 84..118 CDD:409353 11/33 (33%)
Ig strand D 87..94 CDD:409353 2/6 (33%)
Ig strand E 97..103 CDD:409353 2/5 (40%)
Ig strand F 110..118 CDD:409353 2/7 (29%)
CDR3 119..123 CDD:409353 0/3 (0%)
Ig strand G 123..132 CDD:409353 3/8 (38%)
FR4 125..132 CDD:409353 2/6 (33%)
Ig_3 135..206 CDD:404760 15/84 (18%)
Ig strand A 135..138 CDD:409353 0/2 (0%)
Ig strand A' 144..148 CDD:409353 2/10 (20%)
Ig strand B 151..160 CDD:409353 2/8 (25%)
Ig strand C 165..170 CDD:409353 2/11 (18%)
Ig strand C' 171..174 CDD:409353 0/2 (0%)
Ig strand F 198..206 CDD:409353 4/7 (57%)
Ig 224..312 CDD:416386 21/92 (23%)
putative Ig strand A 224..230 CDD:409353 2/5 (40%)
Ig strand B 240..244 CDD:409353 1/3 (33%)
Ig strand C 253..257 CDD:409353 0/3 (0%)
Ig strand E 279..283 CDD:409353 2/3 (67%)
Ig strand F 293..298 CDD:409353 2/4 (50%)
Ig strand G 306..309 CDD:409353 0/2 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143452
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.