Sequence 1: | NP_001286718.1 | Gene: | CG13506 / 37556 | FlyBaseID: | FBgn0034723 | Length: | 503 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001306032.1 | Gene: | OPCML / 4978 | HGNCID: | 8143 | Length: | 354 | Species: | Homo sapiens |
Alignment Length: | 289 | Identity: | 66/289 - (22%) |
---|---|---|---|
Similarity: | 104/289 - (35%) | Gaps: | 44/289 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 79 VEAKPGDDVILNC--DARNFQLSNAVVWYKNRIIIANGQN--PISQRVQCMLNN----SILLRNV 135
Fly 136 SPEDSDDYYCEIL----PQRVRQHTALRVGARLSILCDDRDITDRSQTFRQGDHHKLECRTYLPD 196
Fly 197 NATIKWSFNDLNGQPSSVDNQNGVIILD------NVDEKNAGDYQCLADDGSRHPPHGTVHIDVQ 255
Fly 256 YSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSLKDS--VHNDHNRTT 318
Fly 319 LIVREVTDSDLGEYLCQVENAIGSNEVKV 347 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13506 | NP_001286718.1 | IG_like | 79..146 | CDD:214653 | 20/74 (27%) |
IGc2 | 83..146 | CDD:197706 | 19/70 (27%) | ||
IG_like | 176..254 | CDD:214653 | 17/83 (20%) | ||
Ig | 176..239 | CDD:299845 | 13/68 (19%) | ||
I-set | 258..349 | CDD:254352 | 21/92 (23%) | ||
Ig | 275..348 | CDD:143165 | 17/75 (23%) | ||
OPCML | NP_001306032.1 | Ig | 44..132 | CDD:416386 | 24/90 (27%) |
Ig strand A' | 44..49 | CDD:409353 | 1/3 (33%) | ||
Ig strand B | 51..59 | CDD:409353 | 2/7 (29%) | ||
CDR1 | 59..63 | CDD:409353 | 2/7 (29%) | ||
FR2 | 64..70 | CDD:409353 | 2/5 (40%) | ||
Ig strand C | 64..70 | CDD:409353 | 2/5 (40%) | ||
CDR2 | 71..83 | CDD:409353 | 2/11 (18%) | ||
Ig strand C' | 72..76 | CDD:409353 | 1/3 (33%) | ||
Ig strand C' | 80..83 | CDD:409353 | 0/2 (0%) | ||
FR3 | 84..118 | CDD:409353 | 11/33 (33%) | ||
Ig strand D | 87..94 | CDD:409353 | 2/6 (33%) | ||
Ig strand E | 97..103 | CDD:409353 | 2/5 (40%) | ||
Ig strand F | 110..118 | CDD:409353 | 2/7 (29%) | ||
CDR3 | 119..123 | CDD:409353 | 0/3 (0%) | ||
Ig strand G | 123..132 | CDD:409353 | 3/8 (38%) | ||
FR4 | 125..132 | CDD:409353 | 2/6 (33%) | ||
Ig_3 | 135..206 | CDD:404760 | 15/84 (18%) | ||
Ig strand A | 135..138 | CDD:409353 | 0/2 (0%) | ||
Ig strand A' | 144..148 | CDD:409353 | 2/10 (20%) | ||
Ig strand B | 151..160 | CDD:409353 | 2/8 (25%) | ||
Ig strand C | 165..170 | CDD:409353 | 2/11 (18%) | ||
Ig strand C' | 171..174 | CDD:409353 | 0/2 (0%) | ||
Ig strand F | 198..206 | CDD:409353 | 4/7 (57%) | ||
Ig | 224..312 | CDD:416386 | 21/92 (23%) | ||
putative Ig strand A | 224..230 | CDD:409353 | 2/5 (40%) | ||
Ig strand B | 240..244 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 253..257 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 279..283 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 293..298 | CDD:409353 | 2/4 (50%) | ||
Ig strand G | 306..309 | CDD:409353 | 0/2 (0%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165143452 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |