DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and NCAM2

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_011527877.1 Gene:NCAM2 / 4685 HGNCID:7657 Length:874 Species:Homo sapiens


Alignment Length:377 Identity:89/377 - (23%)
Similarity:154/377 - (40%) Gaps:68/377 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IDADVKGTDYQDDEYEYGDDTDDDDTQIIDVTKNHA---EQEAPPYFDVTDL--------RVEAK 82
            :.:|..|..|.|.....|        ..:|...|.|   |:..|..:..|.|        :||..
Human     2 VRSDSGGQVYLDYHNRQG--------LFVDWKYNEALYLEEGQPETYYRTALLQVTISLSKVELS 58

  Fly    83 PGDDVILNCDARNFQLSNAVVWYKNRIIIANGQNPIS-QRVQCM---LNNSILLRNVSPEDSDDY 143
            .|:.....|.|  .....::.||.     ..|:..|| |||...   :.:.:.:.|.:.||:..|
Human    59 VGESKFFTCTA--IGEPESIDWYN-----PQGEKIISTQRVVVQKEGVRSRLTIYNANIEDAGIY 116

  Fly   144 YCEILPQRVRQHTA---LRVGARLSILCDDRDITDRSQTFRQGDHHKLECRTYLPDNATIKWSFN 205
            .|:....:.:...|   |.:..:|:.    |::.. .|.|:||:..::.||........:.|.::
Human   117 RCQATDAKGQTQEATVVLEIYQKLTF----REVVS-PQEFKQGEDAEVVCRVSSSPAPAVSWLYH 176

  Fly   206 DLNGQPSSV-DNQ------NGVIILDNVDEKNAGDYQCLADDGSRHPPHGTVH-----IDVQYSP 258
              |.:.::: ||:      |.:.|| |:::.:.|.|:|   :| |....|.:.     :.|...|
Human   177 --NEEVTTISDNRFAMLANNNLQIL-NINKSDEGIYRC---EG-RVEARGEIDFRDIIVIVNVPP 234

  Fly   259 IVSTHR--HNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSLKDSVHNDHNRTTLIV 321
            .:|..:  .|...|:|......|.....|.....:.::||.::.::||.||.|      .|.|.|
Human   235 AISMPQKSFNATAERGEEMTFSCRASGSPEPAISWFRNGKLIEENEKYILKGS------NTELTV 293

  Fly   322 REVTDSDLGEYLCQVENAIGSNEVK--VHVSYNPETPQFE-DMTVEGNKVTL 370
            |.:.:||.|.|:|:..|..|.:|.:  :.|...|...|.: :.|.|..:|||
Human   294 RNIINSDGGPYVCRATNKAGEDEKQAFLQVFVQPHIIQLKNETTYENGQVTL 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 17/70 (24%)
IGc2 83..146 CDD:197706 15/66 (23%)
IG_like 176..254 CDD:214653 20/89 (22%)
Ig 176..239 CDD:299845 17/69 (25%)
I-set 258..349 CDD:254352 26/94 (28%)
Ig 275..348 CDD:143165 21/74 (28%)
NCAM2XP_011527877.1 Ig1_NCAM-2 46..137 CDD:143274 20/97 (21%)
I-set 47..136 CDD:254352 20/95 (21%)
I-set 142..218 CDD:254352 20/87 (23%)
IGc2 153..214 CDD:197706 16/67 (24%)
Ig 233..326 CDD:299845 27/98 (28%)
I-set 240..323 CDD:254352 24/88 (27%)
Ig5_NCAM-2 325..422 CDD:143278 7/21 (33%)
IG_like 333..420 CDD:214653 5/13 (38%)
IG_like 438..515 CDD:214653
IGc2 439..507 CDD:197706
FN3 521..613 CDD:238020
fn3 619..703 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.