DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and tutl

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster


Alignment Length:505 Identity:110/505 - (21%)
Similarity:195/505 - (38%) Gaps:113/505 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 HAEQEAPPYFDVT--DLRVEAKPGDDVILNCDARNFQLSNAVVWYKNRIIIANGQNPISQRVQCM 125
            |.:..|||.|.||  |: :....||.:||||.|.... :..::|||:    ||..:| |..|. :
  Fly   246 HLDVHAPPRFSVTPEDI-IYVNLGDSIILNCQADGTP-TPEILWYKD----ANPVDP-SPTVG-I 302

  Fly   126 LNNSILLR--NVSPEDSDDYYC-------EILPQRVRQHTALRVGARLSILCDDRDITDRSQTFR 181
            .|:...||  .:..||..:|.|       ::      .|||..:.|..:::.    :...:||..
  Fly   303 FNDGTELRISTIRHEDIGEYTCIARNGEGQV------SHTARVIIAGGAVIM----VPPTNQTKL 357

  Fly   182 QGDHHKLECRT-YLPDNATIKWSFNDLNGQP----SSVD-----NQNGVIILDNVDEKNAGDYQC 236
            :|:.....|.. .:|.|.|::|.   ..|.|    ::::     .::|.:|::.:...::|.|.|
  Fly   358 EGEKVIFSCEAKAMPGNVTVRWY---REGSPVREVAALETRVTIRKDGSLIINPIKPDDSGQYLC 419

  Fly   237 LADDGSRHPPHGTVHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQ-- 299
            ...:|...|...:.::.|:| |...|....|.         |..:|...:.:.| ||....||  
  Fly   420 EVTNGIGDPQSASAYLSVEY-PAKVTFTPTVQ---------YLPFRLAGVVQCY-IKSSPQLQYV 473

  Fly   300 -------LSDKYSLKDSVHNDHNRTTLIVREVTDSDLGEYLCQVENAIG----SNEVKVHV---- 349
                   |.:.|.:||.|...:.  :|:...|.:...|:|.|...||.|    |..:.|.|    
  Fly   474 TWTKDKRLLEPYQMKDIVVMANG--SLLFTRVNEEHQGQYACTPYNAQGTAGASGVMDVLVRKPP 536

  Fly   350 --SYNPET-----------PQFEDMTVEG-NKVTLHWLVRSHQLLSEAMLD-YQLTGSYTWSTVQ 399
              :..|||           ...:.:..|| .:.|:.|..:..:.|:|:..: .:::|...  |::
  Fly   537 AFTVEPETLYQRKVGDSVEMHCDALEAEGTERPTIKWQRQEGEQLTESQRNRIKISGGNI--TIE 599

  Fly   400 VLETHR--------HNNTDNIWKITHQLELSRGVWHA--RVKTKNTK------------GWSHFS 442
            .|....        .|....:..:| ||.:.....||  .:..|.|:            |.|.:.
  Fly   600 NLRREDFGYYQCVVSNEVATLMAVT-QLVIEGTQPHAPYNITGKATESSITLQWLPGYSGGSEYK 663

  Fly   443 NDHVFEIPEDSEVDKDEEVELPPDEIVQAGIMPMSKGAASSMQRLNVGVI 492
            .|:.....| :.|:..:.:.:.|....|..|..::.|.....|.:...|:
  Fly   664 QDYTIWFRE-AGVNDWQTISVTPSGSTQVTINGLASGTTYEFQVVGRNVL 712

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 22/75 (29%)
IGc2 83..146 CDD:197706 22/71 (31%)
IG_like 176..254 CDD:214653 17/87 (20%)
Ig 176..239 CDD:299845 15/72 (21%)
I-set 258..349 CDD:254352 25/103 (24%)
Ig 275..348 CDD:143165 21/85 (25%)
tutlNP_001303307.1 V-set 137..250 CDD:284989 1/3 (33%)
IG_like 137..229 CDD:214653
I-set 253..341 CDD:254352 30/101 (30%)
IGc2 268..331 CDD:197706 22/69 (32%)
I-set 346..437 CDD:254352 17/97 (18%)
Ig 349..437 CDD:299845 17/90 (19%)
Ig 459..530 CDD:299845 19/73 (26%)
IG_like 549..628 CDD:214653 13/81 (16%)
IGc2 551..617 CDD:197706 10/67 (15%)
FN3 633..725 CDD:238020 15/81 (19%)
FN3 786..874 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.