DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and opcml

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001005580.1 Gene:opcml / 449538 ZFINID:ZDB-GENE-040927-3 Length:342 Species:Danio rerio


Alignment Length:285 Identity:67/285 - (23%)
Similarity:115/285 - (40%) Gaps:26/285 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VEAKPGDDVILNCDARNFQLSNAVVWYKNRIIIANGQNPISQRVQCMLNN------SILLRNVSP 137
            :..:.||..:|.|...| ::|. |.|.....|:..|....|...:.:|.|      ||.:.||:.
Zfish    42 ITVRQGDSAVLKCSMDN-KVSR-VAWLNRTTILFTGNEKWSLDPRVVLLNTAVNEYSIKILNVNL 104

  Fly   138 EDSDDYYCEIL----PQRVRQHTALRVGARLSILCDDRDITDRSQTFRQGDHHKLECRTYLPDNA 198
            .|...|.|.||    |:..:.|..::|.||:..:..|..:       .:|.:..|.|........
Zfish   105 YDEGPYVCSILTNKKPESTKVHLIVQVPARIVNVSTDVSV-------NEGSNVSLMCLAIGRPEP 162

  Fly   199 TIKWSFNDLNGQPSSVDNQNGVIILDNVDEKNAGDYQCLADDGSRHPPHGTVHIDVQYSPIVSTH 263
            :|.|.|....|  :.:..:...:.:..:.:..:|.|.|:..:....|...||.:.|.|.|::|..
Zfish   163 SILWKFRSSKG--NRIVTEGEYVEMTGITKDMSGSYDCITSNDISPPDVRTVQVTVNYPPVISRA 225

  Fly   264 RHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSLKDSVHNDHNRTTLIVREVTDSD 328
            | :..|..|....|:|...|.|:....:.| |:...|:....:|  :.|...::.|....|::.|
Zfish   226 R-STGTAVGQKGVLWCEASAVPLADFQWFK-GERRILNGFNGVK--IENKGKQSMLTFFNVSEED 286

  Fly   329 LGEYLCQVENAIGSNEVKVHVSYNP 353
            .|.|.|...|.:|.....: :.|.|
Zfish   287 YGNYTCVAINTLGITNASI-ILYGP 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 19/72 (26%)
IGc2 83..146 CDD:197706 19/68 (28%)
IG_like 176..254 CDD:214653 13/77 (17%)
Ig 176..239 CDD:299845 10/62 (16%)
I-set 258..349 CDD:254352 22/90 (24%)
Ig 275..348 CDD:143165 17/72 (24%)
opcmlNP_001005580.1 Ig 41..129 CDD:299845 24/88 (27%)
IG_like 41..129 CDD:214653 24/88 (27%)
IG_like 139..216 CDD:214653 14/85 (16%)
IGc2 146..202 CDD:197706 10/57 (18%)
I-set 219..307 CDD:254352 22/92 (24%)
ig 223..307 CDD:278476 21/88 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576341
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.