DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and DIP-gamma

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster


Alignment Length:370 Identity:78/370 - (21%)
Similarity:131/370 - (35%) Gaps:85/370 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GTDYQDDEYEYGDDTDDDDTQIIDVTKNHAEQEAPPYFDVTDLRVEAKPGDDVILNCDARNFQLS 99
            |:....:::.......|.|.:.|....|                |....|.:.||.|..||.. .
  Fly    20 GSGSTQNQHHESSSQLDPDPEFIGFINN----------------VTYPAGREAILACSVRNLG-K 67

  Fly   100 NAVVWYK----------NRIIIANGQNPISQRVQCMLNNSILLRNVSPEDSDDYYCEILPQRVRQ 154
            |.|.|.:          .|::..|.:  ||...|.|....:.:..:...|...|.|:|....:::
  Fly    68 NKVGWLRASDQTVLALQGRVVTHNAR--ISVMHQDMHTWKLKISKLRESDRGCYMCQINTSPMKK 130

  Fly   155 HTALRVGARLSILCDD----RDITDRSQT----FRQGDHHKLECRTYLPDNATIKWSFND----L 207
                :||      |.|    .||.:...:    .::|:...|.|:........:.|...|    |
  Fly   131 ----QVG------CIDVQVPPDIINEESSADLAVQEGEDATLTCKATGNPQPRVTWRREDGEMIL 185

  Fly   208 NGQPSS-----VDNQNGVII-LDNVDEKNAGDYQCLADDGSRHPPHGTVHIDVQYSPIVSTHRHN 266
            ..:|.|     |::.||..: |..::.:..|.|.|:|.:.........|.:.||::|:|......
  Fly   186 IRKPGSRELMKVESYNGSSLRLLRLERRQMGAYLCIASNDVPPAVSKRVSLSVQFAPMVRAPSQL 250

  Fly   267 VNTEKGATAELYCNYRAKPIGRSYFIKDGKT---------------------LQLSDKYSLKDSV 310
            :.|..|:..:|.|...|.|...||::|..:|                     |....||.:.:..
  Fly   251 LGTPLGSDVQLECQVEASPSPVSYWLKGARTSNGFASVSTASLESGSPGPEMLLDGPKYGITERR 315

  Fly   311 HNDHNRTTLIVREVTDSDLGEYLCQVENAIGS-------NEVKVH 348
            ........|:||..:.||:|.|.|...|::|.       .|:|:|
  Fly   316 DGYRGVMLLVVRSFSPSDVGTYHCVSTNSLGRAEGTLRLYEIKLH 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 18/76 (24%)
IGc2 83..146 CDD:197706 17/72 (24%)
IG_like 176..254 CDD:214653 17/91 (19%)
Ig 176..239 CDD:299845 15/76 (20%)
I-set 258..349 CDD:254352 28/119 (24%)
Ig 275..348 CDD:143165 23/100 (23%)
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 25/120 (21%)
Ig 47..129 CDD:299845 21/100 (21%)
Ig 140..238 CDD:299845 19/97 (20%)
IG_like 247..355 CDD:214653 23/107 (21%)
Ig 256..351 CDD:299845 22/94 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.