DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and dpr17

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001287297.1 Gene:dpr17 / 41470 FlyBaseID:FBgn0051361 Length:664 Species:Drosophila melanogaster


Alignment Length:246 Identity:55/246 - (22%)
Similarity:90/246 - (36%) Gaps:56/246 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 LRVEAKPGDDVILNCDARNFQLSNAVVWYK---NRIIIANGQNPIS-QRVQCMLNN------SIL 131
            |.:.|:.|:...:.|...... ...|.|.:   |.||..:....|: :|.|.:...      |:.
  Fly   413 LNITAQMGNHAYMPCQIHRLS-DKPVSWVRMRDNHIISVDETTFIADERFQSIYQEDHDYTWSLQ 476

  Fly   132 LRNVSPEDSDDYYCEILPQRVRQHTALRVGARLSILCDDRD-ITDRSQTFRQGDHHKLEC--RTY 193
            ::.|.|.|:..|.|::..:     ..|.....|.|:....: |.|:|:..:.|....|.|  |..
  Fly   477 IKYVEPSDAGWYECQMATE-----PKLSAKVHLQIVKPKTELIGDQSRFVKAGSKVALHCIVRGT 536

  Fly   194 LPDNATIKWSFN------------------DLNGQPSSVDNQN--GVIILDNVDEKNAGDYQCLA 238
            |.....|.| |.                  |.|...:..||||  |.:|:..|.::::|:|.|  
  Fly   537 LDPPKYIIW-FRGQKKISDSDERTGWYTQLDRNIFGTVGDNQNTIGSLIIPLVRKEDSGNYTC-- 598

  Fly   239 DDGSRHPPHGTVHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRS 289
                  .|..:|.:.|..        |.::.|..|:|.:....|....|||
  Fly   599 ------QPSNSVSVSVDL--------HVLSGEYSASAIMSTAARTTKGGRS 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 16/76 (21%)
IGc2 83..146 CDD:197706 15/72 (21%)
IG_like 176..254 CDD:214653 23/99 (23%)
Ig 176..239 CDD:299845 21/84 (25%)
I-set 258..349 CDD:254352 8/32 (25%)
Ig 275..348 CDD:143165 5/15 (33%)
dpr17NP_001287297.1 IG_like 414..491 CDD:214653 16/77 (21%)
Ig 415..507 CDD:299845 19/97 (20%)
IG_like 521..612 CDD:214653 23/107 (21%)
IGc2 524..605 CDD:197706 21/89 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.