DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and dpr5

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:230 Identity:53/230 - (23%)
Similarity:93/230 - (40%) Gaps:32/230 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 LRNVSPEDSDDYYCEILPQRVRQHTALRVGARLSILCDDRDITDRSQTF-RQGDHHKLE--CRTY 193
            |.|:.| |:.|....:......:.....:|....:.|..|.:.||:.:: ||.|.|.|.  ..||
  Fly    77 LSNLIP-DNYDAIDPVFDNTTDREVIAALGTTARLHCRVRHLGDRAVSWIRQRDLHILTIGIMTY 140

  Fly   194 LPDNATIKWSFNDLNGQPSSVDNQN-GVIILDNVDEKNAGDYQCLADDGSRHPPHGTVHIDVQYS 257
            .          ||.......:||.: .|:.:.:|.:::||.|:|..   |..|     .|.:.|.
  Fly   141 T----------NDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQV---STEP-----KISLAYK 187

  Fly   258 PIVSTHRHNV--NTE----KGATAELYCNYRAKPIGRSYFI--KDGKTLQLSDKYSLKDSVHNDH 314
            .:|.|.:..:  |.|    .|:...|.|.....|...::.:  ||.:.:..|.:..::.......
  Fly   188 LVVVTSKAQILANRELFIQSGSDINLTCIAPQAPGPYTHMLWHKDTELVSDSARGGIRVESEQQM 252

  Fly   315 NRTTLIVREVTDSDLGEYLCQVENAIGSNEVKVHV 349
            ..:.|::..|..:|.|.|.|..:|: .|:.|.||:
  Fly   253 KTSNLVISRVQHTDSGNYTCSADNS-NSDSVFVHI 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 5/13 (38%)
IGc2 83..146 CDD:197706 5/13 (38%)
IG_like 176..254 CDD:214653 21/81 (26%)
Ig 176..239 CDD:299845 18/66 (27%)
I-set 258..349 CDD:254352 21/98 (21%)
Ig 275..348 CDD:143165 15/74 (20%)
dpr5NP_650080.3 V-set 95..191 CDD:284989 26/113 (23%)
IG_like 98..179 CDD:214653 23/93 (25%)
IG_like 206..278 CDD:214653 14/72 (19%)
Ig 211..278 CDD:143165 13/67 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.