DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and Ama

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:301 Identity:64/301 - (21%)
Similarity:131/301 - (43%) Gaps:42/301 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VEAKPGDDVILNCDARNF-QLSNAVVWYK-------NRIIIANGQNPIS---QRVQCMLNN---- 128
            |.|..||.|..||..... |||  |.|.|       |.::::. :|.:|   ||....:..    
  Fly    42 VVASVGDSVEFNCTVEEVGQLS--VSWAKRPSESDTNSVVLSM-RNILSLPDQRYNVTVTEGPKT 103

  Fly   129 -----SILLRNVSPEDSDDYYCEIL---PQRVRQHTALRVGARLSILCDDRDITDRSQTFRQGDH 185
                 :..::|:...|...|.|::|   .::|.:..:|::... .::.::   |.:|....:|.:
  Fly   104 GSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQIKTP-PVIAEN---TPKSTLVTEGQN 164

  Fly   186 HKLECRTYLPDNATIKWSFNDLNGQPSSVDNQNGVIILD------NVDEKNAGDYQCLADDGSRH 244
            .:|.|........||.|:     .:.::|....|.::.:      :|...:.|.|.|:|.:|...
  Fly   165 LELTCHANGFPKPTISWA-----REHNAVMPAGGHLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQ 224

  Fly   245 PPHGTVHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSLKDS 309
            |....:.::|::.|.::..|..:......:|||.|:.:..|.....:.|:|..||.|..:.:.::
  Fly   225 PDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVVWHKNGVPLQSSRHHEVANT 289

  Fly   310 VHNDHNRTTLI-VREVTDSDLGEYLCQVENAIGSNEVKVHV 349
            ..:....|::: :..|.:.|.|:|.|...|.:|..:.::|:
  Fly   290 ASSSGTTTSVLRIDSVGEEDFGDYYCNATNKLGHADARLHL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 21/86 (24%)
IGc2 83..146 CDD:197706 19/82 (23%)
IG_like 176..254 CDD:214653 16/83 (19%)
Ig 176..239 CDD:299845 13/68 (19%)
I-set 258..349 CDD:254352 20/91 (22%)
Ig 275..348 CDD:143165 18/73 (25%)
AmaNP_731114.2 I-set 33..143 CDD:254352 25/103 (24%)
Ig 37..127 CDD:299845 22/87 (25%)
IG_like 154..234 CDD:214653 16/84 (19%)
IGc2 161..223 CDD:197706 14/66 (21%)
I-set 254..330 CDD:254352 18/75 (24%)
IGc2 254..322 CDD:197706 17/67 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442823
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.