DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and Ama

DIOPT Version :10

Sequence 1:NP_611666.2 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:301 Identity:64/301 - (21%)
Similarity:131/301 - (43%) Gaps:42/301 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VEAKPGDDVILNCDARNF-QLSNAVVWYK-------NRIIIANGQNPIS---QRVQCMLNN---- 128
            |.|..||.|..||..... |||  |.|.|       |.::::. :|.:|   ||....:..    
  Fly    42 VVASVGDSVEFNCTVEEVGQLS--VSWAKRPSESDTNSVVLSM-RNILSLPDQRYNVTVTEGPKT 103

  Fly   129 -----SILLRNVSPEDSDDYYCEIL---PQRVRQHTALRVGARLSILCDDRDITDRSQTFRQGDH 185
                 :..::|:...|...|.|::|   .::|.:..:|::... .::.::   |.:|....:|.:
  Fly   104 GSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQI
KTP-PVIAEN---TPKSTLVTEGQN 164

  Fly   186 HKLECRTYLPDNATIKWSFNDLNGQPSSVDNQNGVIILD------NVDEKNAGDYQCLADDGSRH 244
            .:|.|........||.|:     .:.::|....|.::.:      :|...:.|.|.|:|.:|...
  Fly   165 LELTCHANGFPKPTISWA-----REHNAVMPAGGHLLAEPTLRIRSVHRMDRGGYYCIAQNGEGQ 224

  Fly   245 PPHGTVHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSLKDS 309
            |....:.::|::.|.::..|..:......:|||.|:.:..|.....:.|:|..||.|..:.:.::
  Fly   225 PDKRLIRVEVEFRPQIAVQRPKIAQMVSHSAELECSVQGYPAPTVVWHKNGVPLQSSRHHEVANT 289

  Fly   310 VHNDHNRTTLI-VREVTDSDLGEYLCQVENAIGSNEVKVHV 349
            ..:....|::: :..|.:.|.|:|.|...|.:|..:.::|:
  Fly   290 ASSSGTTTSVLRIDSVGEEDFGDYYCNATNKLGHADARLHL 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_611666.2 Ig_3 69..146 CDD:464046 21/86 (24%)
Ig_3 173..238 CDD:464046 14/70 (20%)
Ig 258..349 CDD:472250 20/91 (22%)
Ig strand B 275..279 CDD:409353 3/3 (100%)
Ig strand C 288..292 CDD:409353 0/3 (0%)
Ig strand E 317..321 CDD:409353 1/4 (25%)
Ig strand F 331..336 CDD:409353 2/4 (50%)
AmaNP_731114.2 I-set 33..143 CDD:400151 25/103 (24%)
Ig strand B 50..54 CDD:409353 1/3 (33%)
Ig strand C 63..68 CDD:409353 3/6 (50%)
Ig strand E 101..112 CDD:409353 0/10 (0%)
Ig strand F 122..127 CDD:409353 2/4 (50%)
Ig strand G 136..139 CDD:409353 0/2 (0%)
Ig_3 146..220 CDD:464046 15/82 (18%)
I-set 254..330 CDD:400151 18/75 (24%)
Ig strand B 255..259 CDD:409353 3/3 (100%)
Ig strand C 268..272 CDD:409353 0/3 (0%)
Ig strand E 298..302 CDD:409353 0/3 (0%)
Ig strand F 312..317 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.