DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and LSAMP

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:277 Identity:58/277 - (20%)
Similarity:106/277 - (38%) Gaps:27/277 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 TDLRVEAKPGDDVILNCDARNFQLSNAVVWYKNRIIIANGQN--PISQRVQC----MLNNSILLR 133
            || .:..:.||..||.|...:  .::.|.|.....||..|.:  .:..||:.    .|..|:.::
Human    38 TD-NITVRQGDTAILRCVVED--KNSKVAWLNRSGIIFAGHDKWSLDPRVELEKRHSLEYSLRIQ 99

  Fly   134 NVSPEDSDDYYCEIL----PQRVRQHTALRVGARLSILCDDRDITDRSQTFRQGDHHKLECRTYL 194
            .|...|...|.|.:.    |:..:.:..::|..::|.:..|       .|..:|.:..|.|....
Human   100 KVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSD-------VTVNEGSNVTLVCMANG 157

  Fly   195 PDNATIKWSFNDLNGQPSSVDNQNGVIILDNVDEKNAGDYQCLADDGSRHPPHGTVHIDVQYSPI 259
            .....|.|......|:  ..:.:...:.:..:..:.:|.|:|.|.:.........|.:.|.|.|.
Human   158 RPEPVITWRHLTPTGR--EFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPT 220

  Fly   260 VSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSLKDSVHNDHNRTTLIVREV 324
            ::..:.|..| .|..|.|.|...|.|.....:.:|...:..::...:|.:    ..:::|.|..|
Human   221 ITESKSNEAT-TGRQASLKCEASAVPAPDFEWYRDDTRINSANGLEIKST----EGQSSLTVTNV 280

  Fly   325 TDSDLGEYLCQVENAIG 341
            |:...|.|.|...|.:|
Human   281 TEEHYGNYTCVAANKLG 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 17/72 (24%)
IGc2 83..146 CDD:197706 17/68 (25%)
IG_like 176..254 CDD:214653 12/77 (16%)
Ig 176..239 CDD:299845 10/62 (16%)
I-set 258..349 CDD:254352 20/84 (24%)
Ig 275..348 CDD:143165 16/67 (24%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 21/92 (23%)
Ig 132..215 CDD:386229 14/91 (15%)
Ig_3 219..294 CDD:372822 18/79 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143412
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.