DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and dpr13

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster


Alignment Length:165 Identity:32/165 - (19%)
Similarity:67/165 - (40%) Gaps:25/165 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 SILLRNVSPEDSDDYYCEILPQRVRQHTALRVGARLSILCDDRDITDRS-QTFRQGDHHKLECRT 192
            ::.::.|...|:..|.|:     |..|....:...||::....:||... :....|...:|:||.
  Fly   243 TLQIKFVQLRDAGVYECQ-----VSTHPPTSIFLHLSVV
EARAEITGPPIRYLTPGSTLRLQCRV 302

  Fly   193 -----------YLPDNATIKWSFN---DLNGQPSSVDNQNGVIILDNVDEKNAGDYQCLADDGSR 243
                       :..||..|.:..:   :::.:|   |.|:..:.:.....:::|::.|:|  .:.
  Fly   303 VQNTEASEYIFWYHDNRMINYDIDRGINVSTEP---DFQSSELTIQRTRREHSGNFTCVA--SNT 362

  Fly   244 HPPHGTVHIDVQYSPIVSTHRHNVNTEKGATAELY 278
            .|....|||....:|....|.|...:.|...::|:
  Fly   363 QPASVLVHIFKGDNPAAMYHGHVGGSTKTTQSQLH 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 3/16 (19%)
IGc2 83..146 CDD:197706 3/16 (19%)
IG_like 176..254 CDD:214653 17/92 (18%)
Ig 176..239 CDD:299845 12/77 (16%)
I-set 258..349 CDD:254352 5/21 (24%)
Ig 275..348 CDD:143165 1/4 (25%)
dpr13NP_001033956.2 V-set 180..276 CDD:284989 8/37 (22%)
IG_like 182..262 CDD:214653 4/23 (17%)
IG_like 285..362 CDD:214653 13/81 (16%)
IGc2 292..361 CDD:197706 13/73 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.