DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and dpr20

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:352 Identity:72/352 - (20%)
Similarity:119/352 - (33%) Gaps:125/352 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 ARNFQLSNAVVWYKNRIIIANGQNPIS--QRVQCMLNNSIL--LRNVSPEDSDD-----YYCEIL 148
            |||  .|..:|  :|..:..:.::|:|  |:....:.|.|.  ..:.:.....|     ::.:: 
  Fly   211 ARN--RSTGLV--RNSAVKVDSKHPLSKGQKTDAPMLNYIFDTFSSANKHHHHDQRYGPHFEDV- 270

  Fly   149 PQRVRQHTALRVGARLSILCDDRDITDRSQTFRQGDHHKLECRTYLPDNATIKWSFNDLNGQPSS 213
             ||:.|.|.|.|.|..||                    .|.||..|..:.|:.|..:  |.|...
  Fly   271 -QRIGQATNLTVQAGSSI--------------------HLNCRISLLQDKTVSWVRH--NTQDEG 312

  Fly   214 VDNQNGVIIL---------------------------DNVDEKNAGDYQCLADDGSRHPPHGTVH 251
            .||.|.:.:|                           .||.:.:...|:|..   |.|||.    
  Fly   313 KDNGNALDLLTVGMHTYTGDKRYKMEFQYPNNWRLKITNVKKDDEAIYECQI---STHPPR---- 370

  Fly   252 IDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLS--------------- 301
                   ::..:.| ||..|    .:..:....|:...|:..| .|||||               
  Fly   371 -------VIQINLH-VNAPK----VMIVDEVGDPLQEKYYEID-STLQLSCVVRNVAMTSSVVFW 422

  Fly   302 -------------DKYSLKDSVHNDHNRTTLIVREVTDSDLGEYLCQVENAIGSNEVKVHVSYNP 353
                         ...|:|..:..|...:||.:.:::.:|.|.|.|.: :...:..:.||: .|.
  Fly   423 KHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISKTDSGNYTCSI-SEFQNFTIVVHI-LNG 485

  Fly   354 ETPQFEDMTVEG---------NKVTLH 371
            |:  |.::...|         |.|.||
  Fly   486 ES--FAELHHGGAVGWHSTWWNMVMLH 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 12/61 (20%)
IGc2 83..146 CDD:197706 12/61 (20%)
IG_like 176..254 CDD:214653 20/104 (19%)
Ig 176..239 CDD:299845 16/89 (18%)
I-set 258..349 CDD:254352 22/118 (19%)
Ig 275..348 CDD:143165 17/100 (17%)
dpr20NP_612066.1 IG_like 278..365 CDD:214653 21/111 (19%)
Ig 279..378 CDD:299845 26/135 (19%)
Ig 400..471 CDD:299845 15/72 (21%)
IG_like 402..480 CDD:214653 14/78 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.