DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and babos

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001286719.1 Gene:babos / 37557 FlyBaseID:FBgn0034724 Length:196 Species:Drosophila melanogaster


Alignment Length:150 Identity:43/150 - (28%)
Similarity:70/150 - (46%) Gaps:19/150 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TRLLLISLLI---GQLYVSCAGSPIDADVKGTDYQDDEYEYGDDTDDDDTQIIDVTKNH---AEQ 66
            |.||:..||:   ....:|...|.:|.|..   ..||:::||   .:|.:.....||:.   |.:
  Fly     5 TDLLIAGLLLIVGSAAVISYPQSSMDDDQM---QADDDFDYG---GEDQSAPSPQTKSPNPVASE 63

  Fly    67 EAPPYFDVTDLRVEAKPGDDVILNCD-ARNFQLSNAVV-WYKNRIIIANGQNPISQRVQCMLNNS 129
            :......||.:|     |:||:|.|| ..|...|:.|| ||....:|:||:|.:....:...|..
  Fly    64 KINKTLSVTGIR-----GEDVVLKCDVGSNLHSSDVVVLWYFGDNVISNGKNLVQPNFKLDANYD 123

  Fly   130 ILLRNVSPEDSDDYYCEILP 149
            :.:...||:.:..|.|::||
  Fly   124 LTILKASPQVAGSYLCKVLP 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 20/68 (29%)
IGc2 83..146 CDD:197706 20/64 (31%)
IG_like 176..254 CDD:214653
Ig 176..239 CDD:299845
I-set 258..349 CDD:254352
Ig 275..348 CDD:143165
babosNP_001286719.1 ig 70..154 CDD:278476 25/78 (32%)
IG_like 70..154 CDD:214653 25/78 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.