DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and Lac

DIOPT Version :10

Sequence 1:NP_611666.2 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_523713.2 Gene:Lac / 36363 FlyBaseID:FBgn0010238 Length:359 Species:Drosophila melanogaster


Alignment Length:303 Identity:59/303 - (19%)
Similarity:132/303 - (43%) Gaps:28/303 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 DDDDTQIIDVTKNHAEQEAPPYFDVTDLRVEAKPGDDVILNCDARNFQLSNAVVWYKNRIIIANG 114
            |...|...|.:..:|::     ::|..|:.::.|   |.|:       ..:.:|...:|..:...
  Fly    41 DIGGTVEFDCSVQYAKE-----YNVLFLKTDSDP---VFLS-------TGSTLVIKDSRFSLRYD 90

  Fly   115 QNPISQRVQCMLNNSILLRNVSPEDSDDYYCEILPQRVRQHTA-LRVGARLSILCDDRDITDRSQ 178
            .|..:.::|        ::::...|:..|.|:::...|.:.:| :::..|...:..|.  :.:|.
  Fly    91 PNSSTYKLQ--------IKDIQETDAGTYTCQVVISTVHKVSAEVKLSVRRPPVISDN--STQSV 145

  Fly   179 TFRQGDHHKLECRTYLPDNATIKWSFNDLNGQPS-SVDNQNGVIILDNVDEKNAGDYQCLADDGS 242
            ...:|...::||........||.|...:....|: |.......:.:.:|.:::.|.|.|:||:|.
  Fly   146 VASEGSEVQMECYASGYPTPTITWRRENNAILPTDSATYVGNTLRIKSVKKEDRGTYYCVADNGV 210

  Fly   243 RHPPHGTVHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSLK 307
            .......::::|:::|:::..|..:........:|.|:..|.|.....:.||...|..:..||:.
  Fly   211 SKGDRRNINVEVEFAPVITVPRPRLGQALQYDMDLECHIEAYPPPAIVWTKDDIQLANNQHYSIS 275

  Fly   308 D-SVHNDHNRTTLIVREVTDSDLGEYLCQVENAIGSNEVKVHV 349
            . :..:::..:||.|..|.....|:|:|:..|..|..|.:|::
  Fly   276 HFATADEYTDSTLRVITVEKRQYGDYVCKATNRFGEAEARVNL 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_611666.2 Ig_3 69..146 CDD:464046 11/76 (14%)
Ig_3 173..238 CDD:464046 13/65 (20%)
Ig 258..349 CDD:472250 22/91 (24%)
Ig strand B 275..279 CDD:409353 1/3 (33%)
Ig strand C 288..292 CDD:409353 0/3 (0%)
Ig strand E 317..321 CDD:409353 2/3 (67%)
Ig strand F 331..336 CDD:409353 2/4 (50%)
LacNP_523713.2 IG_like 36..131 CDD:214653 18/112 (16%)
Ig strand B 46..50 CDD:409381 0/3 (0%)
Ig strand C 60..63 CDD:409381 1/2 (50%)
Ig strand E 96..100 CDD:409381 1/11 (9%)
Ig strand F 110..115 CDD:409381 2/4 (50%)
Ig strand G 124..127 CDD:409381 1/2 (50%)
Ig_3 134..208 CDD:464046 15/75 (20%)
Ig 227..318 CDD:472250 21/90 (23%)
Ig strand C 256..260 CDD:409353 0/3 (0%)
Ig strand E 286..290 CDD:409353 2/3 (67%)
Ig strand F 300..305 CDD:409353 2/4 (50%)

Return to query results.
Submit another query.