DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and IL1RAP

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001161403.1 Gene:IL1RAP / 3556 HGNCID:5995 Length:687 Species:Homo sapiens


Alignment Length:510 Identity:107/510 - (20%)
Similarity:176/510 - (34%) Gaps:171/510 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 TKNHAEQEAPPYFDVTDLRVEAKPGDDVILNCDARNFQLSNAVVWYKNRIIIANGQNPISQRVQC 124
            |:...:.|.|..|.:.:.|: :|..|                |:|::..::...|      ...|
Human    73 TRQDRDLEEPINFRLPENRI-SKEKD----------------VLWFRPTLLNDTG------NYTC 114

  Fly   125 MLNNSILLRNVS------PEDSDDYYCEILPQRVRQHTA-LRVGARLSILCDDRDITDRSQTFRQ 182
            ||.|:.....|:      .:||    |...|.::..|.. :..|.: .|.|.:.|          
Human   115 MLRNTTYCSKVAFPLEVVQKDS----CFNSPMKLPVHKLYIEYGIQ-RITCPNVD---------- 164

  Fly   183 GDHHKLECRTYLPDNA--TIKW--------SFNDLNGQPSSVDNQNGVIILDNVDEKNAGDYQCL 237
                     .|.|.:.  ||.|        :||  |..|..: |.:.:|.|.:    |.|:|.|:
Human   165 ---------GYFPSSVKPTITWYMGCYKIQNFN--NVIPEGM-NLSFLIALIS----NNGNYTCV 213

  Fly   238 ADDGSRHPPHG-------TVHIDVQYS------PIVSTHRHNVNTEKGATAEL------YCNYRA 283
            .    .:|.:|       |:.:.|..|      |::.:...:|..||....||      |.::..
Human   214 V----TYPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPNDHVVYEKEPGEELLIPCTVYFSFLM 274

  Fly   284 KPIGRSYFIKDGK-----TLQLSDKYSLKDSVHNDHNRTTLI-VREVTDSDL-GEYLCQVENAIG 341
            ......::..|||     |:.::...|:..|...|..||.:: :::||..|| ..|:|...:|.|
Human   275 DSRNEVWWTIDGKKPDDITIDVTINESISHSRTEDETRTQILSIKKVTSEDLKRSYVCHARSAKG 339

  Fly   342 SNEVKVHVSYNPETPQFEDMTVE-----GNKVTL----------HWL-----VRSHQLLSEAMLD 386
            .......|......|::   |||     |..|.|          :||     .|:|....|.:||
Human   340 EVAKAAKVKQKVPAPRY---TVELACGFGATVLLVVILIVVYHVYWLEMVLFYRAHFGTDETILD 401

  Fly   387 ---YQLTGSYTWSTVQVLETHRHNNTDNIWKITHQLELSRGVWHARVKTKNTKGWS--HFSNDHV 446
               |.:..||.          |:...:....:|     .|||      .:|..|:.  .|..|  
Human   402 GKEYDIYVSYA----------RNAEEEEFVLLT-----LRGV------LENEFGYKLCIFDRD-- 443

  Fly   447 FEIPEDSEVD---------KDEEVELPPDEIVQAGIMPMSKGAASSMQRLNVGVI 492
             .:|..:.|:         :...|.|.||.:.:..|         ||....:||:
Human   444 -SLPGGNTVEAVFDFIQRSRRMIVVLSPDYVTEKSI---------SMLEFKLGVM 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 12/72 (17%)
IGc2 83..146 CDD:197706 11/68 (16%)
IG_like 176..254 CDD:214653 19/94 (20%)
Ig 176..239 CDD:299845 16/72 (22%)
I-set 258..349 CDD:254352 24/103 (23%)
Ig 275..348 CDD:143165 20/85 (24%)
IL1RAPNP_001161403.1 Ig1_IL1R_like 25..132 CDD:409584 15/81 (19%)
Ig strand B 43..47 CDD:409584
Ig strand C 67..71 CDD:409584
Ig strand E 97..101 CDD:409584 2/19 (11%)
Ig strand F 111..116 CDD:409584 1/4 (25%)
Ig strand G 124..127 CDD:409584 1/2 (50%)
Ig2_IL-1RAP_like 143..235 CDD:409585 25/122 (20%)
Ig strand B 156..160 CDD:409585 1/4 (25%)
Ig strand C 174..178 CDD:409585 2/3 (67%)
Ig strand E 195..199 CDD:409585 1/4 (25%)
Ig strand F 209..214 CDD:409585 2/4 (50%)
Ig strand G 226..229 CDD:409585 0/2 (0%)
Ig3_IL1RAP 243..349 CDD:409525 25/105 (24%)
Ig strand B 262..266 CDD:409525 1/3 (33%)
Ig strand C 279..283 CDD:409525 0/3 (0%)
Ig strand E 314..318 CDD:409525 0/3 (0%)
Ig strand F 329..334 CDD:409525 2/4 (50%)
Ig strand G 341..344 CDD:409525 0/2 (0%)
TIR 404..547 CDD:214587 23/118 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.