DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and IL1R1

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_000868.1 Gene:IL1R1 / 3554 HGNCID:5993 Length:569 Species:Homo sapiens


Alignment Length:315 Identity:70/315 - (22%)
Similarity:124/315 - (39%) Gaps:66/315 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VEAKPGDDVILNCDARNFQLSNAVVWYKNRIIIANGQNPISQRVQCMLN---NSILLRNVSPEDS 140
            ::.:|       |.....:....:.|||:     :.:.|:|......::   ..:.......|||
Human    39 IDVRP-------CPLNPNEHKGTITWYKD-----DSKTPVSTEQASRIHQHKEKLWFVPAKVEDS 91

  Fly   141 DDYYCEILPQRVRQHT-ALRVGARLSILCDDRDITDRSQT-FRQ-----GDHHKLEC-------- 190
            ..|||.     ||..: .||:......:.::.::...:|. |:|     || ..|.|        
Human    92 GHYYCV-----VRNSSYCLRIKISAKFVENEPNLCYNAQAIFKQKLPVAGD-GGLVCPYMEFFKN 150

  Fly   191 -RTYLPDNATIKWSFNDLNGQPSSVDN--QNGV---IILDNVDEKNAGDYQCLADD---GSRHPP 246
             ...||   .::| :.|.  :|..:||  .:||   :|:.||.||:.|:|.|.|..   |.::|.
Human   151 ENNELP---KLQW-YKDC--KPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPI 209

  Fly   247 HGTVHIDV--QYSP----IVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYS 305
            ...:....  :..|    |||.....:..:.|:..:|.||...:....:|:..:|..:...|...
Human   210 TRVIEFITLEENKPTRPVIVSPANETMEVDLGSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVL 274

  Fly   306 LKD--SVHNDHN--RTTLI-VREVTDSDLGEY----LCQVENAIGSNEVKVHVSY 351
            .:|  ||.|..|  |:||| |..:::.:...|    .|..:|..|.:...:.:.|
Human   275 GEDYYSVENPANKRRSTLITVLNISEIESRFYKHPFTCFAKNTHGIDAAYIQLIY 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 12/69 (17%)
IGc2 83..146 CDD:197706 12/65 (18%)
IG_like 176..254 CDD:214653 27/100 (27%)
Ig 176..239 CDD:299845 24/82 (29%)
I-set 258..349 CDD:254352 25/103 (24%)
Ig 275..348 CDD:143165 20/81 (25%)
IL1R1NP_000868.1 Ig1_IL1R_like 24..113 CDD:319308 17/90 (19%)
Ig2_IL1R_like 128..219 CDD:319309 26/97 (27%)
IG 234..328 CDD:214652 21/93 (23%)
TIR 384..540 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.