DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and dpr19

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001260336.1 Gene:dpr19 / 34408 FlyBaseID:FBgn0032233 Length:385 Species:Drosophila melanogaster


Alignment Length:374 Identity:71/374 - (18%)
Similarity:131/374 - (35%) Gaps:93/374 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DTQIIDVTKNHAEQEAPPYFDV-TDLRVEAKPGDDVILNCDARNFQLSNAVVWYKNR--IIIANG 114
            |...|..::||........|:. .:.||.|:.|...||.|..: ......|.|.:.:  .::..|
  Fly    23 DVGKITSSQNHFGNTLQSQFNTKNNTRVIAQKGGLAILPCVVK-VNSPATVSWIRRKDFQLLTVG 86

  Fly   115 QNPISQRVQCMLNN-------SILLRNVSPEDSDDYYCE--ILPQRVRQHTALRVGARLSILCDD 170
            .:..|...:.::.:       |:.::.|..||...|.|:  |.|.:       .:...|.|:...
  Fly    87 LSTHSSDKRFLVEHTRHMGHWSLRIKAVREEDRGFYECQLSIYPTQ-------SIVIELKIVEAV 144

  Fly   171 RDIT-------DRSQTFRQGDHHKLECR-TYLPDNATIKWSFNDLNGQPSSVDNQNGVIILDNVD 227
            .:|:       |.:.|.|      |||: ....:|....:.::|  .:..:.|:|.|.::     
  Fly   145 AEISSAPELHIDETSTLR------LECKLKRATENPAFVFWYHD--SKMINYDSQGGFVV----- 196

  Fly   228 EKNAGDYQCLADDGSRHPPHGTVHIDVQYSPI--------VSTHRHNVNTEKGATAELYCNYRAK 284
                      ...|..:|..|..:   :.||.        :.:....:|:..|::..:.......
  Fly   197 ----------TSIGQSNPQSGQFY---RSSPANKSRATMPMESSNGVLNSLLGSSDAIKAPAANV 248

  Fly   285 PIGRSYFIKDGKTLQLSDKYSLKDSVHNDHNRTTLIVREVTDSDLGEYLCQVENAIGSNEVKVHV 349
            |....|.     |.|....|.|..||      :.|.|::|.....|.|.|...||..:: :.|||
  Fly   249 PSSTPYM-----TQQHQSAYLLNPSV------SVLTVKQVNFRHAGNYTCAPSNARPAS-ITVHV 301

  Fly   350 SYNPETPQFEDMTVEGNKVTLHWLVRSHQLLSEAMLDYQLTGSYTWSTV 398
                         :.|.|..      :.|..:.::||.:..|:.|:..:
  Fly   302 -------------LRGEKTA------AMQHANRSILDTETNGNGTFGLI 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 15/75 (20%)
IGc2 83..146 CDD:197706 13/71 (18%)
IG_like 176..254 CDD:214653 13/78 (17%)
Ig 176..239 CDD:299845 10/63 (16%)
I-set 258..349 CDD:254352 20/98 (20%)
Ig 275..348 CDD:143165 16/72 (22%)
dpr19NP_001260336.1 IG_like 50..127 CDD:214653 16/77 (21%)
IGc2 55..125 CDD:197706 13/70 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.