DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and itgb4

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_005166847.1 Gene:itgb4 / 335269 ZFINID:ZDB-GENE-030131-7209 Length:1931 Species:Danio rerio


Alignment Length:516 Identity:94/516 - (18%)
Similarity:166/516 - (32%) Gaps:181/516 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PISQRVQCMLNNSILLRNVSPEDSDDYYCEILPQRVRQHTALRVGARLSI--------------- 166
            |.|.|..||....:.   .:|...:..||:....:.::........|.|.               
Zfish   511 PCSGRGDCMCGTCVC---YNPNQFEGPYCQFDKSQCQRFGGFLCNERGSCSMGRCVCSPGWSGEA 572

  Fly   167 ----------------LCDDRDITDRSQTFRQGDHHKLEC-RTYLPDNATIKWSFNDLNG----- 209
                            :|:||.:....         :.|| .:.||.:.|.:.:|....|     
Zfish   573 CECPTSNDSCRDSKGGICNDRGVCKCG---------RCECEHSGLPLSPTCEANFQQQVGMCEAK 628

  Fly   210 ------QPSSVDNQNG---------VIILDNVDE-KNAGDYQCLADDGSRHPPHGTVHIDVQYSP 258
                  |..|...:.|         ::.:|.::| ||..:.....|:..    ..|.|.:|.|..
Zfish   629 RSCVQCQAWSTGERKGRKCDECPFKIVRVDELEEDKNVIETCSFRDEDD----DCTYHYNVNYPS 689

  Fly   259 IVSTHRHNVNTEK--------------------------------------GATAELYCNYRAKP 285
            .::...|.|..:|                                      ...|.|.|..|.:.
Zfish   690 NITDKEHRVLVKKKKDCPPAGFLWLIPLIMFLMLLLGLLLLCCWKYCACCQSCLALLPCCARGRM 754

  Fly   286 IGRSYFIKDGKTLQLSDKYSLKDS-VHNDHNRTTLIVRE--VTDSDLGEYLCQVENAIGSNEVKV 347
            :|    .|:       ::|.|:.| :.||:..|.: ||.  :..:|:..:........|:|..:.
Zfish   755 VG----FKE-------NQYLLRQSFLQNDYLDTPM-VRSGPLKSTDVVRWKVADNVHRGTNHPQN 807

  Fly   348 HVSYNP-ETPQFE---DMTVEGNKVTLHWLVRSHQLLSEAMLD------YQLTGSY----TWSTV 398
            .:..|| ||.|:.   .:..:.::|..:...|...:|...:.|      .|:.|:.    |....
Zfish   808 QIRPNPKETIQYPVSLRLNRQFSEVLSNPDARDTDMLRREVEDNLNDVFLQIPGAQPVQKTLFRT 872

  Fly   399 QVLETHRHNNT-------------DNIWKITHQLELSRGVWHARVKTKNTK------GWSHFSND 444
            |.....|.|||             .:|.|:|.:          :|::.|.:      |:...::|
Zfish   873 QRNSGKRQNNTIVDTVLSAPRSSYPDIVKLTDK----------QVQSGNFRDLKVIPGYYTVASD 927

  Fly   445 H----VFEIPEDSE-VD-------KDEEVELPPDEIVQAGIMPMSKGAAS-SMQRLNVGVI 492
            .    ..|.||:.| ||       |||:.| ..:.:|||..:|:  |.|. ....:|:.|:
Zfish   928 KEAAGAVEFPENVESVDVRVPLFIKDEDDE-KKELLVQAVDVPV--GIAKIGKDHVNITVL 985

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 7/28 (25%)
IGc2 83..146 CDD:197706 7/28 (25%)
IG_like 176..254 CDD:214653 17/99 (17%)
Ig 176..239 CDD:299845 14/84 (17%)
I-set 258..349 CDD:254352 20/131 (15%)
Ig 275..348 CDD:143165 17/75 (23%)
itgb4XP_005166847.1 Integrin_beta 37..457 CDD:278776
EGF_2 <468..490 CDD:285248
EGF_2 545..573 CDD:285248 2/27 (7%)
Integrin_B_tail 625..709 CDD:285239 15/87 (17%)
Calx-beta 991..1064 CDD:295344
FN3 1242..1326 CDD:238020
FN3 1331..1420 CDD:238020
fn3 1640..1720 CDD:278470
fn3 1751..1835 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.