DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and CG33543

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001014458.3 Gene:CG33543 / 3346207 FlyBaseID:FBgn0053543 Length:468 Species:Drosophila melanogaster


Alignment Length:393 Identity:80/393 - (20%)
Similarity:141/393 - (35%) Gaps:129/393 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 GQNPISQRVQCMLNNSILLRNVSPEDSDDYYCEILPQR--------VRQHTA---LRVGARLSIL 167
            |:..|.::...:|  :::..:::.||..::.||:...|        .|:..|   |.|..::|. 
  Fly    93 GRVHIEKKTTGLL--ALVFEHIALEDRGNWTCEVNGNRNGNRNVNVEREFLASFELLVNQKISF- 154

  Fly   168 CDDRDITDRSQTFRQGDHHKLECRTYLPDNATIKWSFND--LNGQPSSVDNQ--NGVIILDNVDE 228
                ..|::.|:.|:|....:.|.........:.|.:|.  :|...|:..|:  ||:.| .||.:
  Fly   155 ----GKTEQVQSVREGRDAMVNCFVEGMPAPEVSWLYNGEYINTVNSTKHNRLSNGLYI-RNVSQ 214

  Fly   229 KNAGDYQCLA-------DDGS--------RHPPHGTVH--IDVQYSPIVSTHRHNVNTEKGATAE 276
            .:||:|.|.|       .|..        :|.||...:  :.|||:.:            |....
  Fly   215 ADAGEYTCRAMRITPTFSDSDQITILLRIQHKPHWFFNETLPVQYAYV------------GGAVN 267

  Fly   277 LYCNYRAKP-------------IGRSY--FIKD-GKTLQLSDKYSLKDSVHNDHNRTTLIVREVT 325
            |.|:...:|             :|.::  |:.| |.||||..|.:                    
  Fly   268 LSCDAMGEPPPSFTWLHNNKGIVGFNHRIFVADYGATLQLQMKNA-------------------- 312

  Fly   326 DSDLGEYLCQVENAIGSNE--VKVHVSYNPETPQFEDMTVEGNKVTLHWLVRSHQLLSEAMLDYQ 388
             |..|:|.|:|.|.:|..|  :|:.....|..|:                            .:|
  Fly   313 -SQFGDYKCKVANPLGMLERVIKLRPGPKPLGPR----------------------------RFQ 348

  Fly   389 LTGSYTWSTVQVLETHRHNNTDNIWKI---------THQLELSRGVW-HARVKTKNTKGWSHFSN 443
            |...||......::|.|.:|..:..:|         ..:.:.|.|.| :|:.:..:..|..||..
  Fly   349 LKKLYTNGFELDIQTPRMSNVSDEMQIYGYRVAYMSDTEFKFSAGNWSYAKQRDFSFHGGKHFII 413

  Fly   444 DHV 446
            .|:
  Fly   414 PHL 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 5/31 (16%)
IGc2 83..146 CDD:197706 5/31 (16%)
IG_like 176..254 CDD:214653 23/98 (23%)
Ig 176..239 CDD:299845 19/73 (26%)
I-set 258..349 CDD:254352 22/108 (20%)
Ig 275..348 CDD:143165 21/90 (23%)
CG33543NP_001014458.3 IGc2 165..224 CDD:197706 16/59 (27%)
IG_like 256..336 CDD:214653 25/112 (22%)
IGc2 263..327 CDD:197706 19/84 (23%)
FN3 341..445 CDD:238020 18/104 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442849
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.