DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and dpr18

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_573102.1 Gene:dpr18 / 32572 FlyBaseID:FBgn0030723 Length:519 Species:Drosophila melanogaster


Alignment Length:493 Identity:94/493 - (19%)
Similarity:163/493 - (33%) Gaps:151/493 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RLLLISLLIGQ----LYVSCAGSPIDADVKGTDYQDDEYEYGDDTDDDDTQIIDVTKNHAEQEAP 69
            |||.|:|:||.    ||.:      ..:.|.....    |...:.::......|..|..:.....
  Fly    34 RLLTIALVIGSQVQVLYTT------SVETKSPSAS----EQSRNGENRSLLFDDYNKTKSTLSTA 88

  Fly    70 PYFDVTDLRVEAKPGDDVILNCDARNFQLSNAVVWYKNRIIIANGQNPISQRVQC---------- 124
            .|...|...:.|....|...:......:.|||            ..:||..::..          
  Fly    89 DYLSATRATLYAFSSQDQDEDHSQMPIEASNA------------PHSPIPTKMSRGKIPMETPGS 141

  Fly   125 --MLNNSILLRNVSPEDSDDYYCEILP--------------------QRVRQHTALRVGARLSIL 167
              ..:||:.::||.  .:|......:|                    .|.|.|......||    
  Fly   142 MEFSSNSLPIKNVG--TTDQLTTVTMPTTAFASLKVDRSTMKQPIDSTRTRNHWTASGFAR---- 200

  Fly   168 CDDRDITDRSQTFRQGDHH----------------------------KLECRTYLPDNATIKW-- 202
                 :|:|.::....:||                            .|.||..:..:.|:.|  
  Fly   201 -----VTERPRSKHHHEHHWGPFFEEPINSATSGDNLVSAVHLFTEAVLNCRVGMLKDKTVMWVR 260

  Fly   203 ------SFNDLNGQPSSVDNQ---------NGVIILDNVDEKNAGDYQCLADDGSRHPPH-GTVH 251
                  |...:.....|.|.:         |..::::....::||.|.|..   |.|||. .|.:
  Fly   261 RTAEKVSLLTVGNVTYSGDPRIRVKFQYPNNWRLLINPTQTEDAGVYMCQV---STHPPRVFTTN 322

  Fly   252 IDVQYSP--IVSTHRHNVNT---EKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSLKDSVH 311
            :.|...|  |:..|..:|..   :.|:|.:|.|.     |.||:|.|:.:|: |....|..|:|.
  Fly   323 LTVLEPPLRIIDEHERDVGDRYYKSGSTVDLQCQ-----ISRSFFQKERQTI-LKSTDSANDAVQ 381

  Fly   312 NDHNRTTLIVREVTDSDLGEYLCQVENAIGSNEVKVH----VSYNPETPQFEDMTVEGNKVTLHW 372
            ...|.||      ::.:|...:.|.::.....:::.:    :::..:....:.||.....|:..|
  Fly   382 KLINETT------SELNLIGNVNQTQHKFSGQDLEKYFTKFITWAKDEEPLQGMTNRRLSVSDVW 440

  Fly   373 LVRSHQLLSEAMLDYQLTGSYTWS---------TVQVL 401
            |. |...:.:|.|..  :|:|:.|         .||||
  Fly   441 LT-SRISIGDAKLSD--SGNYSCSLGRLFTVIVQVQVL 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 12/78 (15%)
IGc2 83..146 CDD:197706 11/74 (15%)
IG_like 176..254 CDD:214653 21/123 (17%)
Ig 176..239 CDD:299845 16/107 (15%)
I-set 258..349 CDD:254352 23/99 (23%)
Ig 275..348 CDD:143165 17/72 (24%)
dpr18NP_573102.1 IG_like 242..325 CDD:214653 18/85 (21%)
Ig <258..326 CDD:299845 14/70 (20%)
IGc2 <417..461 CDD:197706 10/46 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.