Sequence 1: | NP_001286718.1 | Gene: | CG13506 / 37556 | FlyBaseID: | FBgn0034723 | Length: | 503 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001285239.1 | Gene: | dpr8 / 32387 | FlyBaseID: | FBgn0052600 | Length: | 344 | Species: | Drosophila melanogaster |
Alignment Length: | 205 | Identity: | 43/205 - (20%) |
---|---|---|---|
Similarity: | 73/205 - (35%) | Gaps: | 67/205 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 187 KLECRTYLPDNATIKW-SFNDLN----GQPSSVDNQ-----------NGVIILDNVDEKNAGDYQ 235
Fly 236 CLADDGSRHPPHG-TVHIDV--QYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKT 297
Fly 298 LQLSDKYSLKDSVHNDHNR---------------------TT--LIVREVTDSDLGEYLCQVENA 339
Fly 340 IGSNEVKVHV 349 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13506 | NP_001286718.1 | IG_like | 79..146 | CDD:214653 | |
IGc2 | 83..146 | CDD:197706 | |||
IG_like | 176..254 | CDD:214653 | 19/83 (23%) | ||
Ig | 176..239 | CDD:299845 | 14/67 (21%) | ||
I-set | 258..349 | CDD:254352 | 23/113 (20%) | ||
Ig | 275..348 | CDD:143165 | 18/95 (19%) | ||
dpr8 | NP_001285239.1 | IG_like | 51..131 | CDD:214653 | 15/72 (21%) |
V-set | 52..143 | CDD:284989 | 19/84 (23%) | ||
IG_like | 153..238 | CDD:214653 | 21/106 (20%) | ||
ig | 153..232 | CDD:278476 | 20/100 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |