DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and Igsf9b

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001363879.1 Gene:Igsf9b / 315510 RGDID:1564717 Length:1441 Species:Rattus norvegicus


Alignment Length:304 Identity:78/304 - (25%)
Similarity:118/304 - (38%) Gaps:54/304 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 HAEQEAPPYFDVTDLR-VEAKPGDDVILNCDARNFQLSN---AVVWYK-NRIIIANGQNPISQRV 122
            |....|||.|..|..: :|||.|..:.:.|.|    ..|   .|.|.| ..::.|:|:..:|   
  Rat   132 HLTINAPPTFTETPPQYIEAKEGGSITMTCTA----FGNPKPIVTWLKEGTLLSASGKYQVS--- 189

  Fly   123 QCMLNNSILLRNVSPEDSDDYYCEILP-QRVRQHTA-LRVGARLSILCDDRDIT-DRSQTFRQGD 184
                :.|:.:.:||.||...|.|.... |....||. |.|.....|:....:|| :.||      
  Rat   190 ----DGSLTVTSVSREDRGAYTCRAYSIQGEAVHTTHLLVQGPPFIVSPPENITVNISQ------ 244

  Fly   185 HHKLECRT-YLPDNATIKWSFNDLNGQPSSVDNQN-----------GVIILDNVDEKNAGDYQCL 237
            ...|.||. ..|.|.|..|.:.|.|     |..||           |.:|:..|..::||.|.|:
  Rat   245 DALLTCRAEAYPGNLTYTWYWQDEN-----VYFQNDLKLRVRILIDGTLIIFRVKPEDAGKYTCV 304

  Fly   238 ADDGSRHPPHGTVHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSY-FIKDGKTLQLS 301
            ..:.....|..:.::.|||...|......:....|....:.|...|:|..... :.|||:.||:.
  Rat   305 PSNSLGRSPSASAYLTVQYPARVLNMPPVIYVPVGIHGYIRCPVDAEPPATVVKWNKDGRPLQVE 369

  Fly   302 DKYS---LKDSVHNDHNRTTLIVREVTDSDLGEYLCQVENAIGS 342
            ....   ::|.        ::.:.|.|:..||.|.|...|.:|:
  Rat   370 KNLGWTLMEDG--------SIRIEEATEEALGTYTCVPYNTLGT 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 19/70 (27%)
IGc2 83..146 CDD:197706 16/66 (24%)
IG_like 176..254 CDD:214653 22/89 (25%)
Ig 176..239 CDD:299845 21/74 (28%)
I-set 258..349 CDD:254352 19/89 (21%)
Ig 275..348 CDD:143165 17/72 (24%)
Igsf9bNP_001363879.1 PHA03247 <898..1246 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 918..1044
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1111..1332
Ig 41..115 CDD:319273
I-set 139..225 CDD:369462 27/96 (28%)
Ig 229..321 CDD:386229 25/102 (25%)
Ig <353..414 CDD:386229 14/61 (23%)
Ig 438..502 CDD:319273
FN3 510..605 CDD:238020
FN3 621..703 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 762..821
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.