DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and Fas2

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster


Alignment Length:318 Identity:75/318 - (23%)
Similarity:124/318 - (38%) Gaps:60/318 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VEAKP-GDDVILNC--DARNFQLSNAVVWYKNR----IIIANGQNPISQRVQCMLNNS--ILLRN 134
            |:.|| |..:||.|  ......|...:.|..||    :...||:|......:.:...|  :::.:
  Fly    41 VQRKPVGKPLILTCRPTVPEPSLVADLQWKDNRNNTILPKPNGRNQPPMYTETLPGESLALMITS 105

  Fly   135 VSPEDSDDYYC-------EILPQRVRQHTALRVGARLSILCDDRDIT----DRSQTFRQGDHHKL 188
            :|.|....|||       |||.:.|...|.:.             ||    ..:|....|..:.:
  Fly   106 LSVEMGGKYYCTASYANTEILEKGVTIKTYVA-------------ITWTNAPENQYPTLGQDYVV 157

  Fly   189 ECRTYLPDNATIKWSFNDLNGQPSSVDNQ------NGVIILDNVDEKNAGDYQCLA---DDGSRH 244
            .|......|.||.|.   .||.|....|.      ||::| .||.|.:.|.|.|.|   :.|.. 
  Fly   158 MCEVKADPNPTIDWL---RNGDPIRTTNDKYVVQTNGLLI-RNVQESDEGIYTCRAAVIETGEL- 217

  Fly   245 PPHGTVHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQL--SDKYSLK 307
             ...|:.::|...|.:.:...|:...:|......|..|.||:....:|:|...|.:  :|::.: 
  Fly   218 -LERTIRVEVFIQPEIISLPTNLEAVEGKPFAANCTARGKPVPEISWIRDATQLNVATADRFQV- 280

  Fly   308 DSVHNDHNRTTLI-VREVTDSDLGEYLCQVENAIG--SNEVKVHVSYNPETPQFEDMT 362
                  :.:|.|: :..|:..|.|.|.|..:|..|  ..:.|::|...|:..:..::|
  Fly   281 ------NPQTGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQIYELYNVT 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 20/82 (24%)
IGc2 83..146 CDD:197706 18/78 (23%)
IG_like 176..254 CDD:214653 23/86 (27%)
Ig 176..239 CDD:299845 21/71 (30%)
I-set 258..349 CDD:254352 21/95 (22%)
Ig 275..348 CDD:143165 18/77 (23%)
Fas2NP_001284854.1 IG_like 39..133 CDD:214653 24/91 (26%)
IG_like 144..226 CDD:214653 23/87 (26%)
IGc2 152..209 CDD:197706 19/60 (32%)
I-set 230..319 CDD:254352 21/95 (22%)
IGc2 243..309 CDD:197706 17/72 (24%)
IG_like 330..424 CDD:214653 1/3 (33%)
IGc2 339..412 CDD:197706
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.