DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and kirre

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001245505.1 Gene:kirre / 31292 FlyBaseID:FBgn0028369 Length:956 Species:Drosophila melanogaster


Alignment Length:422 Identity:84/422 - (19%)
Similarity:151/422 - (35%) Gaps:110/422 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKARDSTRLLLISLLIGQLYVSCAGSPIDADVKGTDYQDDEYEYGDDTDDDDTQ------IIDVT 60
            :|...|:|||::.|:: .|.::....||....|....:..:..:..|:....:.      .....
  Fly     1 MKRMRSSRLLVLPLIL-VLILTLLLQPIAVHAKSKKNKSSQSSHHGDSSSSSSSSSSSSGSSSAA 64

  Fly    61 KNHAEQEAPP--------YFDVTDLRVEAKPGDDVILNCDARNFQLSNAVVWYKNRIIIANGQNP 117
            .:.|..|:.|        :|.:......|..|..|.|.|  |..:...|:.|.|:...:...:|.
  Fly    65 ASSANDESKPKGGDNGGQHFAMEPQDQTAVVGSRVTLPC--RVMEKVGALQWTKDDFGLGQHRNL 127

  Fly   118 ISQRVQCMLNN------SILLRNVSPEDSDDYYCEILP-----QRVRQHTALRVGARLSILCDDR 171
            .......|:.:      |:.:..:..:|...|.|::.|     |.:|...     |:|::|    
  Fly   128 SGFERYSMVGSDEEGDFSLDIYPLMLDDDAKYQCQVGPGPQGEQGIRSRF-----AKLTVL---- 183

  Fly   172 DITDRSQTFRQGDH--------HKLECRTYLPDNATIKWSFNDLNGQPSS----VDNQNGVII-- 222
             :...:....|||:        .:|||.:.              .|:|::    :|....|:.  
  Fly   184 -VPPEAPKITQGDYLVTTEDREIELECVSQ--------------GGKPAAEITWIDGLGNVLTKG 233

  Fly   223 LDNVDEKNAGDYQCLADDGSRHPP----HGTVH------------------IDVQYSP-----IV 260
            ::.|.|..|...:..|....:..|    |.|..                  ::|:|:|     :|
  Fly   234 IEYVKEPLADSRRITARSILKLAPKKEHHNTTFTCQAQNTADRTYRSAKLLLEVKYAPKVIVSVV 298

  Fly   261 STHRHNVNTEKGATAELYCNYRAKPIGRSY--FIKDGKTLQLSDKYSLKDSVHNDHNRTTLIVRE 323
            ..........:||...|.|...|.|...||  ||.|  .|...| ::.|..:||       :.|:
  Fly   299 GGALAGGKIPEGAEVILSCQADANPHELSYRWFIND--ELMTGD-FTTKMIIHN-------VSRQ 353

  Fly   324 VTDSDLGEYLCQVENAIGSNE--VKVHVSYNP 353
            ..|:.:   .|:|.||:|.:|  .|:.:|:.|
  Fly   354 YHDAIV---KCEVVNAVGKSEQSKKLDISFGP 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 14/72 (19%)
IGc2 83..146 CDD:197706 13/68 (19%)
IG_like 176..254 CDD:214653 17/113 (15%)
Ig 176..239 CDD:299845 13/76 (17%)
I-set 258..349 CDD:254352 27/99 (27%)
Ig 275..348 CDD:143165 23/76 (30%)
kirreNP_001245505.1 Ig 87..183 CDD:299845 20/102 (20%)
IG_like 88..182 CDD:214653 20/100 (20%)
C2-set_2 189..279 CDD:285423 17/103 (17%)
Ig_2 307..379 CDD:290606 25/84 (30%)
I-set 382..462 CDD:254352 1/1 (100%)
IGc2 396..446 CDD:197706
Ig 466..561 CDD:299845
IG_like 478..561 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.