DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and Kirrel1

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_006232737.1 Gene:Kirrel1 / 310695 RGDID:727883 Length:805 Species:Rattus norvegicus


Alignment Length:500 Identity:99/500 - (19%)
Similarity:181/500 - (36%) Gaps:155/500 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 PPYFDVTDLRVEAKP------GDDVILNCDARNFQLSNAVVWYKNRI----------IIANG--Q 115
            ||    .|.|::..|      |....|.|.|.|.:.:..::|:::..          ::.:|  :
  Rat   151 PP----EDTRIDGGPVILLQAGTPYNLTCRAFNAKPAATIIWFRDGTQQEGAVTSTELLKDGKRE 211

  Fly   116 NPISQRVQCMLNNSILLRNVSPEDSD---DYYCEILPQRVRQHTALRVGARLSILCDDR-----D 172
            ..|||.:            :.|.|.|   .:.|..:      :.|:..|...||..|..     .
  Rat   212 TTISQLL------------IQPTDLDIGRVFTCRSM------NEAIPNGKETSIELDVHHPPTVT 258

  Fly   173 ITDRSQTFRQGDHHKLECR-TYLPDNATIKWSFNDLNGQPSSVDNQNGVIILDNVD---EKNAGD 233
            ::...||..:|:.....|: |..|:....:|:             :.|.:|.|..:   |.|. |
  Rat   259 LSIEPQTVLEGERVIFTCQATANPEILGYRWA-------------KGGFLIEDAHESRYETNV-D 309

  Fly   234 YQCLADD---------GSRHPPHGTVHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAK-PIGR 288
            |....:.         ||.:.   :..::|.::|.:..:.....|:.|:...|.|.:... |:..
  Rat   310 YSFFTEPVSCEVYNKVGSTNV---STLVNVHFAPRIVVYPKPTTTDIGSDVTLTCVWVGNPPLTL 371

  Fly   289 SYFIKD---GKTLQLS-DKYSLKDSVHNDHNRTTLIVREVTDSDLGEYLCQV---ENAIGSNEVK 346
            ::..||   |..|..| .:.:|...|.::.|:  |:::.||.:|.|.|.|:.   ...:...||.
  Rat   372 TWTKKDSNMGPRLPGSPPEANLSAQVLSNSNQ--LLLKSVTQADAGTYTCRAIVPRIGVAEREVP 434

  Fly   347 VHVSYNP----ETPQFEDMTVEGNKV-----------TLHWLVRSHQL----LSEAMLDYQLTGS 392
            ::|:..|    |..||. :..:|.||           .:.|..:.:.|    |....::...:||
  Rat   435 LYVNGPPIISSEAVQFA-VRGDGGKVECFIGSTPPPDRIAWAWKENFLEVGTLERYTVERTNSGS 498

  Fly   393 YTWSTVQVLETHRHNNTDNIWKITHQLELSRGVWHARVKTK-NTKGWSHFSNDHVFEIPEDSEVD 456
            ...||:.:      ||                |..|..:|. |...|:.|.       |..:.:.
  Rat   499 GVLSTLTI------NN----------------VMEADFQTHYNCTAWNSFG-------PGTAIIQ 534

  Fly   457 KDEEVELPPDEIVQAGIMPMSKGAASSMQRLNVGVILL---AALL 498
            .:|.      |::..||:   .||.     :..|::|:   |||:
  Rat   535 LEER------EVLPVGII---AGAT-----IGAGILLVFSFAALV 565

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 14/87 (16%)
IGc2 83..146 CDD:197706 14/83 (17%)
IG_like 176..254 CDD:214653 16/90 (18%)
Ig 176..239 CDD:299845 14/66 (21%)
I-set 258..349 CDD:254352 23/98 (23%)
Ig 275..348 CDD:143165 20/80 (25%)
Kirrel1XP_006232737.1 I-set 54..148 CDD:254352
Ig 57..148 CDD:299845
Ig2_KIRREL3-like 170..251 CDD:143236 17/98 (17%)
I-set 255..336 CDD:254352 16/97 (16%)
Ig_2 259..337 CDD:290606 16/94 (17%)
Ig_2 340..437 CDD:290606 23/98 (23%)
IG_like 346..437 CDD:214653 22/92 (24%)
Ig5_KIRREL3 439..536 CDD:143306 23/126 (18%)
IG_like 451..536 CDD:214653 19/114 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.