DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and Il18r1

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001100375.1 Gene:Il18r1 / 301365 RGDID:1308589 Length:537 Species:Rattus norvegicus


Alignment Length:329 Identity:66/329 - (20%)
Similarity:124/329 - (37%) Gaps:77/329 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 EAPPYFDVTDLRVEAKPGDDVILNCDARNFQLSNAVVWYKNRIIIANGQNPISQRVQCML---NN 128
            |..|::        .||.|   ::....|.:.: .:.|:|..  .::|...::.|....:   .:
  Rat    32 EGEPFY--------LKPCD---MSAPMHNNETA-TMRWFKGN--ASHGYRELNMRSSPRIAFHGH 82

  Fly   129 SILLRNVSPEDSDDYYCEILPQRVRQHTALRVGARLSILC-DDRDITDRSQTFRQGDHHKLECRT 192
            ::....|..||...|:.::  ...||:..|.|..|....| .::.:|:|....::......|..:
  Rat    83 ALEFWPVELEDKGTYFSQV--GNDRQNWTLNVTKRNKHSCFSEKLVTNRDVEVKKSLWITCENPS 145

  Fly   193 Y--LPDNATIKWSFNDLNGQPSSVDNQNGVIILDNVDEKNAGDYQCLAD---DGSRHPPHGTVHI 252
            |  |.::..:..:..:::..|         :||.:.:..:.|.|.|:..   :|.::....||:|
  Rat   146 YGELINHTLLYKNCKEISKTP---------MILKDAEFGDEGYYSCVFSVHHNGQQYNITKTVNI 201

  Fly   253 DV-----QYSP-IVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKY------- 304
            .|     :.:| |..:....|..|.|...||.|:               ..|..:|.:       
  Rat   202 TVIEGNSKITPAIFGSKSAKVGVELGEDVELNCS---------------AVLNRNDLFYWSIRKE 251

  Fly   305 -SLKDSVHNDHNRTT------------LIVREVTDSDLGE-YLCQVENAIGSNEVKVHVSYNPET 355
             ||..:||.|.|.||            |.:::||:..|.. |.|.|.|. .:.:.|..:....||
  Rat   252 DSLDPNVHEDRNETTWTFEGKLHASKILRIQKVTEKYLNVLYNCTVANE-EATDTKSFILVRKET 315

  Fly   356 PQFE 359
            |..:
  Rat   316 PDIQ 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 12/69 (17%)
IGc2 83..146 CDD:197706 11/65 (17%)
IG_like 176..254 CDD:214653 14/82 (17%)
Ig 176..239 CDD:299845 10/64 (16%)
I-set 258..349 CDD:254352 27/112 (24%)
Ig 275..348 CDD:143165 22/93 (24%)
Il18r1NP_001100375.1 Ig_2 22..112 CDD:290606 17/95 (18%)
Ig <156..205 CDD:299845 11/57 (19%)
IG_like 224..310 CDD:214653 24/101 (24%)
TIR 370..519 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.