DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and Lsamp

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_030104997.1 Gene:Lsamp / 268890 MGIID:1261760 Length:392 Species:Mus musculus


Alignment Length:343 Identity:68/343 - (19%)
Similarity:120/343 - (34%) Gaps:77/343 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 KNHAEQEAPPYFDV-----TDLRVEAKPGDDVILNCDARNFQLSNAVVWYKNRIIIANGQN--PI 118
            |...|:|..|...|     || .:..:.||..||.|...:  .::.|.|.....||..|.:  .:
Mouse    50 KKAKEEEGLPVRSVDFNRGTD-NITVRQGDTAILRCVVED--KNSKVAWLNRSGIIFAGHDKWSL 111

  Fly   119 SQRVQC----MLNNSILLRNVSPEDSDDYYCEIL----PQRVRQHTALRVGARLSILCDDRDITD 175
            ..||:.    .|..|:.::.|...|...|.|.:.    |:..:.:..::|..::|.:..|     
Mouse   112 DPRVELEKRHALEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSD----- 171

  Fly   176 RSQTFRQGDHHKLECRTYLPDNATIKWSFNDLNGQPSSV-------------DNQNGVIILDNVD 227
              .|..:|.:..|.|..               ||:|..|             :.:...:.:..:.
Mouse   172 --VTVNEGSNVTLVCMA---------------NGRPEPVITWRHLTPLGREFEGEEEYLEILGIT 219

  Fly   228 EKNAGDYQCLADDGSRHPPHGTVHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFI 292
            .:.:|.|:|.|.:.........|.:.|.|.|.::..:.|..| .|..|.|.|...|.|.....:.
Mouse   220 REQSGKYECKAANEVSSADVKQVKVTVNYPPTITESKSNEAT-TGRQASLKCEASAVPAPDFEWY 283

  Fly   293 KDGKTLQLSDKYSLKDSVHNDHNRTTLIVREVTDSDLGEYLCQVENAIG---------------- 341
            :|...:..::...:|.:    ..:::|.|..||:...|.|.|...|.:|                
Mouse   284 RDDTRINSANGLEIKST----EGQSSLTVTNVTEEHYGNYTCVAANKLGVTNASLVLFKRVLPTV 344

  Fly   342 ---SNEVKVHVSYNPETP 356
               ..|:...|.:.|:.|
Mouse   345 PHPIQEIGTTVHFKPKGP 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 17/72 (24%)
IGc2 83..146 CDD:197706 17/68 (25%)
IG_like 176..254 CDD:214653 13/90 (14%)
Ig 176..239 CDD:299845 11/75 (15%)
I-set 258..349 CDD:254352 21/109 (19%)
Ig 275..348 CDD:143165 17/91 (19%)
LsampXP_030104997.1 Ig 69..159 CDD:386229 21/92 (23%)
Ig_3 163..232 CDD:372822 14/90 (16%)
Ig_3 250..325 CDD:372822 18/79 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833579
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.