DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and Il1r1

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_037255.3 Gene:Il1r1 / 25663 RGDID:2892 Length:590 Species:Rattus norvegicus


Alignment Length:317 Identity:74/317 - (23%)
Similarity:126/317 - (39%) Gaps:57/317 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 DARNFQLS------NAVVWYKNRIIIANGQNPIS----QRVQCMLNNSILLRNVSPEDSDDYYCE 146
            |.|:..|:      ..::||||     :.:.|||    .|:. ..|..:.......|||..||| 
  Rat    56 DIRSCPLTPNEMHGGTIIWYKN-----DSKTPISADKDSRIH-QQNEHLWFVPAKMEDSGYYYC- 113

  Fly   147 ILPQRVRQHT-ALRVGARLSILCDDRDITDRSQ-TFRQGDHHKLECRTYLPDNATIKWSFNDL-- 207
                .:|..| .|:....:|:|.:|..:...:| :|.|..|...:.....|.....|...|:|  
  Rat   114 ----IMRNSTYCLKTKITMSVLENDPGLCYNTQASFIQRLHVAGDGSLVCPYLDFFKDENNELPK 174

  Fly   208 -----NGQPSSVDNQN-----GVIILDNVDEKNAGDYQCLAD---DGSRHPPHGTV-HIDVQYS- 257
                 |.:|..:|:.|     ..:::.||.|::.|:|.|...   .|.::|....: .|.:..| 
  Rat   175 VQWYKNCKPLPLDDGNFFGFKNKLMVMNVAEEHRGNYTCRTSYTYQGKQYPVTRVITFITIDDSK 239

  Fly   258 ---PIVSTHRH-NVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSLKDSVHNDHNR-- 316
               |::.:.|: .:..:.|:|.:|.||...:.....|:..:|..::..|....:|....:|..  
  Rat   240 RDRPVIMSPRNETMEADPGSTIQLICNVTGQFTDLVYWKWNGSEIEWDDPILAEDYQFLEHPSAK 304

  Fly   317 ------TTLIVREVTDSDLGEY--LCQVENAIGSNEVKVHVSYNPETPQFEDMTVEG 365
                  |||.|.|| .|....|  :|.|:|........|.:.|  ..|.|::..:.|
  Rat   305 RKYTLITTLNVSEV-KSQFYRYPFICFVKNTHILETAHVRLVY--PVPDFKNYLIGG 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 17/63 (27%)
IGc2 83..146 CDD:197706 17/63 (27%)
IG_like 176..254 CDD:214653 21/94 (22%)
Ig 176..239 CDD:299845 18/75 (24%)
I-set 258..349 CDD:254352 24/101 (24%)
Ig 275..348 CDD:143165 19/82 (23%)
Il1r1NP_037255.3 Ig 47..130 CDD:299845 21/84 (25%)
Ig2_IL1R_like 144..236 CDD:143234 20/91 (22%)
Ig_3 242..333 CDD:290638 22/91 (24%)
IG_like 251..344 CDD:214653 22/93 (24%)
TIR 401..556 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.