DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and Il1rl1

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001121161.1 Gene:Il1rl1 / 25556 RGDID:2894 Length:566 Species:Rattus norvegicus


Alignment Length:311 Identity:73/311 - (23%)
Similarity:117/311 - (37%) Gaps:52/311 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 PPYFDVTDLRVEA--KPGDDVILNCDARNFQLSNAVVWYKNRIIIANGQNPISQRVQCMLNNSIL 131
            |.||.||:.|..:  ...:.:|:.|..|...: |.|.||.:.   .|.:.|..:|.:..::...|
  Rat    18 PMYFIVTEGRKTSWGLENEALIVRCPQRGGAI-NPVEWYYSN---TNERIPTQKRNRIFVSRDRL 78

  Fly   132 -LRNVSPEDSDDYYCEILPQRVRQHTALRVGARLSIL-------CDDRDITDRSQTFRQGDHHKL 188
             ......|||..|.|.|     |...:::.|: |::.       |...|....|.......:.|:
  Rat    79 KFLPAKVEDSGIYTCVI-----RSPESIKTGS-LNVTIYKRPPNCKIPDYMMYSTVDGSDKNSKI 137

  Fly   189 ECRTYLPDN--ATIKWSFNDLNGQPSSVDNQNGVIILDNVDEKNAGDYQCLADDGSRHPPHGTVH 251
            .|.|....|  |.::|..|....|..........:.:|.|...:.|||.|    ...|..:||.:
  Rat   138 TCPTIALYNWTAPVQWFKNCKALQGPRFRAHMSYLFIDKVSHVDEGDYTC----RFTHTENGTNY 198

  Fly   252 I----------DVQYS--PIVST--HRHNVNTEKGATAELYCN--------YRAK--PIGRSYFI 292
            |          :..:|  |:::.  |.:.|..|.|.||.:.|:        :.|.  .|.::...
  Rat   199 IVTATRSFTVEEKGFSTFPVITNPPHNYTVEVEIGKTANIACSACFGTASQFVAVLWQINKTRIG 263

  Fly   293 KDGKTLQLSDKYSLKDSVHNDHNRTTLI-VREVTDSDLG-EYLCQVENAIG 341
            ..||.....:|...|.|.:.....|:|: :..|||.|.. :|.|...|..|
  Rat   264 SFGKARIQEEKGPNKSSSNGMICLTSLLRITGVTDKDFSLKYDCVAMNHHG 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 15/69 (22%)
IGc2 83..146 CDD:197706 15/63 (24%)
IG_like 176..254 CDD:214653 19/89 (21%)
Ig 176..239 CDD:299845 15/64 (23%)
I-set 258..349 CDD:254352 25/98 (26%)
Ig 275..348 CDD:143165 19/79 (24%)
Il1rl1NP_001121161.1 Ig 28..110 CDD:299845 20/91 (22%)
IG_like 31..110 CDD:214653 20/88 (23%)
Ig2_IL1R_like 123..210 CDD:143234 19/90 (21%)
IG_like 136..209 CDD:214653 18/76 (24%)
Flexible linker. /evidence=ECO:0000250 204..216 1/11 (9%)
Ig 217..314 CDD:299845 24/96 (25%)
TIR 384..539 CDD:279864
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.