| Sequence 1: | NP_001286718.1 | Gene: | CG13506 / 37556 | FlyBaseID: | FBgn0034723 | Length: | 503 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001157990.1 | Gene: | Iglon5 / 210094 | MGIID: | 2686277 | Length: | 336 | Species: | Mus musculus |
| Alignment Length: | 302 | Identity: | 65/302 - (21%) |
|---|---|---|---|
| Similarity: | 111/302 - (36%) | Gaps: | 64/302 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 81 AKPGDDVILNCDARNFQLS-------NAVVWY-KNRIIIANGQNPISQ-RVQCMLNN----SILL 132
Fly 133 RNVSPEDSDDYYCEI----------------LPQR---VRQHTALRVGARLSILCDDRDITDRSQ 178
Fly 179 TFRQGDHHKLECRTYLPDNATIKWSFNDLNGQPSSVDNQNGVIILDNVDEKNAGDYQCLADDGSR 243
Fly 244 HPPHG-TVHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSLK 307
Fly 308 DSVHNDHNRTTLIVREVTDSDLGEYLCQVENAIGSNEVKVHV 349 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG13506 | NP_001286718.1 | IG_like | 79..146 | CDD:214653 | 20/77 (26%) |
| IGc2 | 83..146 | CDD:197706 | 20/75 (27%) | ||
| IG_like | 176..254 | CDD:214653 | 13/78 (17%) | ||
| Ig | 176..239 | CDD:299845 | 10/62 (16%) | ||
| I-set | 258..349 | CDD:254352 | 23/90 (26%) | ||
| Ig | 275..348 | CDD:143165 | 19/72 (26%) | ||
| Iglon5 | NP_001157990.1 | Ig | 41..129 | CDD:416386 | 19/88 (22%) |
| Ig strand A' | 41..46 | CDD:409353 | 0/5 (0%) | ||
| Ig strand B | 48..56 | CDD:409353 | 3/7 (43%) | ||
| CDR1 | 56..60 | CDD:409353 | 0/3 (0%) | ||
| FR2 | 61..68 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C | 61..67 | CDD:409353 | 2/5 (40%) | ||
| CDR2 | 69..79 | CDD:409353 | 2/9 (22%) | ||
| Ig strand C' | 71..74 | CDD:409353 | 1/2 (50%) | ||
| Ig strand C' | 76..79 | CDD:409353 | 0/2 (0%) | ||
| FR3 | 80..115 | CDD:409353 | 11/34 (32%) | ||
| Ig strand D | 84..91 | CDD:409353 | 2/6 (33%) | ||
| Ig strand E | 94..100 | CDD:409353 | 3/5 (60%) | ||
| Ig strand F | 107..115 | CDD:409353 | 2/7 (29%) | ||
| CDR3 | 116..120 | CDD:409353 | 0/3 (0%) | ||
| Ig strand G | 120..129 | CDD:409353 | 0/8 (0%) | ||
| FR4 | 122..129 | CDD:409353 | 0/6 (0%) | ||
| Ig strand A | 132..137 | CDD:409353 | 2/4 (50%) | ||
| Ig_3 | 134..199 | CDD:404760 | 15/91 (16%) | ||
| Ig strand A' | 140..145 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 148..157 | CDD:409353 | 2/8 (25%) | ||
| Ig strand C | 163..167 | CDD:409353 | 1/3 (33%) | ||
| Ig strand D | 174..177 | CDD:409353 | 1/18 (6%) | ||
| Ig strand E | 178..183 | CDD:409353 | 0/4 (0%) | ||
| Ig strand F | 191..199 | CDD:409353 | 3/7 (43%) | ||
| Ig_3 | 217..295 | CDD:404760 | 21/80 (26%) | ||
| putative Ig strand A | 218..224 | CDD:409353 | 2/6 (33%) | ||
| Ig strand B | 234..238 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 247..251 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 274..278 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 288..293 | CDD:409353 | 2/4 (50%) | ||
| Ig strand G | 301..304 | CDD:409353 | 0/2 (0%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167833618 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.830 | |||||