DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and zig-2

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_510069.1 Gene:zig-2 / 192087 WormBaseID:WBGene00006979 Length:238 Species:Caenorhabditis elegans


Alignment Length:206 Identity:45/206 - (21%)
Similarity:69/206 - (33%) Gaps:53/206 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 RDITDRSQTFRQGDHHKLECRTYLPDNATIKWSFNDLNGQPSSVDNQNGVIILDN---------- 225
            |...|.:.||  |:...|.|........:|.|..|.:..|.....|....|:.|.          
 Worm    37 RTPNDSNVTF--GEKFVLSCGANGAPLPSIYWELNGMRIQGEETSNVYENILNDGKQVSNAAMVS 99

  Fly   226 -------VDEKNAGDYQCLADDGSRHPPH----------GTVHIDVQYSPIVS-THRHNVNTEKG 272
                   ...:|:|.|:|:.|:|.....|          ....::...:|.:| |....:.....
 Worm   100 SHYRIPCATARNSGAYKCIIDNGLTKLEHVAKVFVGGNKTNCALNDNGAPFISMTVDFRLEISNN 164

  Fly   273 ATAELYCNYRAKPI-------GRSYFIKDGKTLQLSDKYSLKDSVHNDHNRTTLIVREVTDSDLG 330
            |.| |.|  |::..       |......||      ::|.:..|       ..||:|.::.||:|
 Worm   165 AVA-LSC--RSETATEWSWHKGEQLLTNDG------ERYQMFPS-------GDLIIRNISWSDMG 213

  Fly   331 EYLCQVENAIG 341
            ||.|...|..|
 Worm   214 EYNCTARNHFG 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653
IGc2 83..146 CDD:197706
IG_like 176..254 CDD:214653 19/104 (18%)
Ig 176..239 CDD:299845 16/79 (20%)
I-set 258..349 CDD:254352 24/92 (26%)
Ig 275..348 CDD:143165 20/74 (27%)
zig-2NP_510069.1 I-set 34..134 CDD:254352 21/98 (21%)
Ig 34..121 CDD:299845 18/85 (21%)
Ig <179..232 CDD:299845 16/59 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.