DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and DSCAM

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001380.2 Gene:DSCAM / 1826 HGNCID:3039 Length:2012 Species:Homo sapiens


Alignment Length:405 Identity:84/405 - (20%)
Similarity:146/405 - (36%) Gaps:132/405 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VEAKPGDDVILNCDARNFQLSNAVVWYKNRIIIANGQNPISQRVQCMLNNSIL-LRNVSPE-DSD 141
            :.|..|.|..::|....:.. .::.||||..::     |.:.|.....||..| |.:|..| |..
Human   513 ITAIAGRDTYIHCRVIGYPY-YSIKWYKNSNLL-----PFNHRQVAFENNGTLKLSDVQKEVDEG 571

  Fly   142 DYYCEIL--PQRVRQ---HTALRV--------------GARLSILCDDRDITDRSQTFRQGDHHK 187
            :|.|.:|  ||....   |..::|              |.|:.|.|          ....||   
Human   572 EYTCNVLVQPQLSTSQSVHVTVKVPPFIQPFEFPRFSIGQRVFIPC----------VVVSGD--- 623

  Fly   188 LECRTYLPDNATIKWSFNDLNGQPSSVDNQNGVIILDNVDEKNA-----------GDYQCLADDG 241
                  ||  .||.|   ..:|:|  :....||.| ||:|..::           |:|.|:|.:.
Human   624 ------LP--ITITW---QKDGRP--IPGSLGVTI-DNIDFTSSLRISNLSLMHNGNYTCIARNE 674

  Fly   242 SRHPPHGTVHIDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPI-------------------- 286
            :....|.: .:.|:..|.......:.:...|....|.|:....|:                    
Human   675 AAAVEHQS-QLIVRVPPKFVVQPRDQDGIYGKAVILNCSAEGYPVPTIVWKFSKGAGVPQFQPIA 738

  Fly   287 --GRSYFIKDGKTLQLSDKYSLKDSVHNDHNRTTLIVREVTDSDLGEYLCQVENAIGSN------ 343
              ||...:.:|                      :|:::.|.:.|.|.|||:|.|.:|::      
Human   739 LNGRIQVLSNG----------------------SLLIKHVVEEDSGYYLCKVSNDVGADVSKSMY 781

  Fly   344 ---EVKVHVSYNPETP-----QFEDM--TVEGNK-VTLHWLVRSHQLLSEAMLDYQLT----GSY 393
               ::...::..|.|.     |.::|  |..|.| :.:.| .:..::::..|..|.::    |..
Human   782 LTVKIPAMITSYPNTTLATQGQKKEMSCTAHGEKPIIVRW-EKEDRIINPEMARYLVSTKEVGEE 845

  Fly   394 TWSTVQVLETHRHNN 408
            ..||:|:|.|.|.::
Human   846 VISTLQILPTVREDS 860

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 18/68 (26%)
IGc2 83..146 CDD:197706 17/64 (27%)
IG_like 176..254 CDD:214653 20/88 (23%)
Ig 176..239 CDD:299845 18/73 (25%)
I-set 258..349 CDD:254352 18/121 (15%)
Ig 275..348 CDD:143165 16/103 (16%)
DSCAMNP_001380.2 Ig 45..113 CDD:319273
I-set 235..310 CDD:254352
I-set 315..385 CDD:333254
Ig_3 407..488 CDD:316449
IGc2 518..575 CDD:197706 17/62 (27%)
I-set 596..686 CDD:333254 24/117 (21%)
Ig_DSCAM 707..784 CDD:143211 16/98 (16%)
Ig 802..889 CDD:325142 15/60 (25%)
FN3 885..978 CDD:238020
FN3 986..1083 CDD:238020
FN3 1091..1184 CDD:238020
FN3 1189..1278 CDD:238020
Ig 1303..1369 CDD:319273
FN3 1380..1470 CDD:238020
FN3 1486..1555 CDD:238020
Required for netrin-mediated axon repulsion of neuronal growth cones. /evidence=ECO:0000250|UniProtKB:Q9ERC8 1617..2012
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1718..1810
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1855..1883
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1971..2012
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.