DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and Ncam2

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_001106679.1 Gene:Ncam2 / 17968 MGIID:97282 Length:837 Species:Mus musculus


Alignment Length:453 Identity:92/453 - (20%)
Similarity:166/453 - (36%) Gaps:88/453 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 DDDTQIIDVTKN-------HAEQEAPPYFDVTDLRV-----------------EAKPGDDVILNC 91
            :::.||:::.|:       ....||....|..|:.|                 .|:.|:::.|.|
Mouse   168 NNNLQILNINKSDEGIYRCEGRVEARGEIDFRDIIVIVNVPPAIMMPQKSFNATAERGEEMTLTC 232

  Fly    92 DARNFQLSNAVVWYKNRIIIANGQNPISQRVQCMLNNSILLRNVSPEDSDDYYCEILPQRVRQHT 156
            .|.. .....:.|::|..:|...:..|.:.    .|..:.:||:..:|...|.|:...:......
Mouse   233 KASG-SPDPTISWFRNGKLIEENEKYILKG----SNTELTVRNIINKDGGSYVCKATNKAGEDQK 292

  Fly   157 ALRVGARLSILCDDRDITDRSQTFRQGDHHKLECRTYLPDNATIKWS-------FNDLNGQPS-- 212
            .    |.|.:......:..:::|..:..|..|.|.........|.|.       |::.:..|.  
Mouse   293 Q----AFLQVFVQPHILQLKNETTSENGHVTLVCEAEGEPVPEITWKRAIDGVMFSEGDKSPDGR 353

  Fly   213 -SVDNQNGVIILDNVDEK--NAGDYQCLADDGSRHPPH-GTVHIDVQYSPIVSTHRHNVNTEKGA 273
             .|..|:|...|...|.|  ::|.|.|.|  .||...| .::|:|::|:|...:::....:.:|.
Mouse   354 IEVKGQHGRSSLHIRDVKLSDSGRYDCEA--ASRIGGHQRSMHLDIEYAPKFVSNQTMYYSWEGN 416

  Fly   274 TAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSLKDSVHNDHNRTTLIVREVTDSDLGEYLCQVEN 338
            ...:.|:..|.|....::.::...|...:...||  .|:...:..|.:...:|:|.|.|.|...|
Mouse   417 PINISCDVTANPPASIHWRREKLLLPAKNTTHLK--THSVGRKMILEIAPTSDNDFGRYNCTATN 479

  Fly   339 AIGS--NEVKVHVSYNPETP------QFEDMT--VEGNKVTLHWLVRSHQLLSEAMLDYQLTGSY 393
            .||:  .|..:.::..|.:|      :....|  :..||...|..|..|..    .:|.:...|.
Mouse   480 RIGTRFQEYILELADVPSSPHGVKIIELSQTTAKISFNKPESHGGVPIHHY----QVDVKEVASE 540

  Fly   394 TW--------STVQVLETHRHNNTDNIWKITHQLELSRGVWHARVKTKNTKGWSHFSNDHVFE 448
            ||        .|:.||.:...|.|                :..||...|.||...:|...:|:
Mouse   541 TWKIVRSHGVQTMVVLSSLEPNTT----------------YEIRVAAVNGKGQGDYSKIEIFQ 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 15/83 (18%)
IGc2 83..146 CDD:197706 13/62 (21%)
IG_like 176..254 CDD:214653 22/90 (24%)
Ig 176..239 CDD:299845 17/74 (23%)
I-set 258..349 CDD:254352 19/92 (21%)
Ig 275..348 CDD:143165 17/74 (23%)
Ncam2NP_001106679.1 Ig1_NCAM-2 21..112 CDD:143274
I-set 22..111 CDD:254352
I-set 117..193 CDD:254352 4/24 (17%)
IGc2 128..189 CDD:197706 3/20 (15%)
Ig 208..301 CDD:299845 17/101 (17%)
I-set 215..298 CDD:254352 17/91 (19%)
Ig 300..397 CDD:299845 22/98 (22%)
IG_like 308..395 CDD:214653 21/88 (24%)
IG_like 413..491 CDD:214653 18/79 (23%)
IGc2 414..482 CDD:197706 15/69 (22%)
FN3 496..588 CDD:238020 24/112 (21%)
fn3 594..678 CDD:278470
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 764..810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.