DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and rig-4

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_501339.2 Gene:rig-4 / 177597 WormBaseID:WBGene00004371 Length:2325 Species:Caenorhabditis elegans


Alignment Length:463 Identity:89/463 - (19%)
Similarity:149/463 - (32%) Gaps:127/463 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YVSCAGSPIDADVKGTDYQDDEYEYGDDTDDDDTQIIDVTKNHAEQEAPP---------YFDVTD 76
            :|:..|:.:...||..|:  ..|:. ..:.||..:|:....|..:....|         ||....
 Worm   171 FVTSDGNLVVTGVKRDDF--GAYKL-MASSDDLKEIVSKEYNVRDNGLSPSLQNTLSIVYFPTDR 232

  Fly    77 LRVEAKPGDDVILNC--------DARNFQLSNAVVWYKNRIIIANGQNPISQRV--QCMLNN-SI 130
            ..:|:....|.|.:|        |.|       :.|:      .|||......|  ...||| .:
 Worm   233 TIIESTLPHDEIFDCVTSFGSKDDVR-------IRWF------LNGQQISGSEVGMTTTLNNRRL 284

  Fly   131 LLRNVSPEDSDDYYCEILPQRVRQHTALRVGARLSILCDD--RDITDRSQTFRQGDHHKLECRTY 193
            ::.|.|.....::..|.........|:.:..|.::.:...  :|:.:..|. ..|....|:|...
 Worm   285 IISNPSSFTRGEHKLECRADAAMGRTSDQKSAYMTFISRPILKDLPNEIQK-TVGSSLSLKCSVK 348

  Fly   194 LPDNATIKWSFNDLNGQPSSVDNQNGVIILDNVDEKNAGDYQC---------------------- 236
            ...:..|||..|.|     .:..|.|.:.:|.:.:.:.|.|||                      
 Worm   349 KKSSMDIKWYKNGL-----MMTTQRGKLTIDRIKQDDFGLYQCEATNAAGADLASVWVKEGEANE 408

  Fly   237 -----LADDG---------SRHPPHGTVHID-----VQYSPIVS---THRHNVNTEKGATAE--- 276
                 :::||         ...||......|     .|..|..|   ..:..:.|.|..|..   
 Worm   409 TVATEMSEDGMSLEEEISMETPPPRKLKFFDNSKSQEQLFPFTSELEPSQKLIKTPKDLTVASGT 473

  Fly   277 ----LYCNYRAKPIGRSYFIKDGKTLQLSDKYSLKDSVHNDHNRTTLIVREVTDSDLGEYLCQVE 337
                :.|.....|.....::.:|..:|       .|:|..|.....|.:.::..||.|||.|::.
 Worm   474 DRIMMECAATGSPPPNIIWLLNGHEIQ-------TDNVKYDLTNDGLAIHDIRKSDEGEYTCEIS 531

  Fly   338 NAIGSN-----EVKVH----VSYNPETPQFEDMTVEGNKVTLHWLVRSHQLLSEAMLDYQLTGSY 393
               |||     .|:|:    :.|.|.    :..::.|..|         :...|...:|....|.
 Worm   532 ---GSNVKATANVQVNGDSLIEYGPA----DQKSLIGTNV---------EFSCEVAKEYVRKASV 580

  Fly   394 TWSTVQVL 401
            .|....||
 Worm   581 EWYLNDVL 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 16/77 (21%)
IGc2 83..146 CDD:197706 15/73 (21%)
IG_like 176..254 CDD:214653 21/118 (18%)
Ig 176..239 CDD:299845 16/89 (18%)
I-set 258..349 CDD:254352 24/109 (22%)
Ig 275..348 CDD:143165 18/84 (21%)
rig-4NP_501339.2 IG_like 330..402 CDD:214653 16/77 (21%)
IGc2 338..393 CDD:197706 15/59 (25%)
I-set 459..543 CDD:254352 21/93 (23%)
IGc2 478..534 CDD:197706 15/65 (23%)
IG_like 553..639 CDD:214653 9/49 (18%)
Ig 564..635 CDD:143165 7/34 (21%)
FN3 643..747 CDD:238020
FN3 756..850 CDD:238020
FN3 858..954 CDD:238020
FN3 959..1042 CDD:238020
FN3 1057..1151 CDD:238020
FN3 1156..1251 CDD:238020
FN3 1258..1356 CDD:238020
FN3 1361..1453 CDD:238020
FN3 1464..1560 CDD:238020
FN3 1572..1664 CDD:238020
FN3 1679..1764 CDD:238020
FN3 1774..1858 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.