DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and zig-8

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_499714.1 Gene:zig-8 / 176732 WormBaseID:WBGene00006985 Length:268 Species:Caenorhabditis elegans


Alignment Length:260 Identity:53/260 - (20%)
Similarity:92/260 - (35%) Gaps:55/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 IIANGQNPISQRVQCML-------NNSILLRNVSPEDSDDYYCEILPQRVRQHTALRVGARLSIL 167
            :.|.|.....:.:.|:.       |.|..:.||..|:....:|.:.|....:....||.      
 Worm    15 LYATGHGASEEVMACLRQERSRVENPSQTIVNVVAENPAYLHCSVPPDAEHEIAWTRVS------ 73

  Fly   168 CDDRDITDRSQTFRQGDHHKLECRTYLPDNATIKWSFNDLNGQPSSVDNQNGVIILDNVDEKNAG 232
             |...:|..::||.:..                :|       |.|.......|:.|...:::::|
 Worm    74 -DGALLTAGNRTFTRDP----------------RW-------QVSKKSANIWVLNLRRAEQQDSG 114

  Fly   233 DYQCLADDGSRHPPHGTVHIDVQYSPIVSTHRHNVNTEK------GATAELYCNY----RAKPIG 287
            .|.|..:|  :|.....|::.|...|:.|.......:.|      |....|.|..    :.:.:.
 Worm   115 CYLCEIND--KHNTVYAVYLKVLEPPLPSPSSLQKKSTKLMANMSGDEVVLNCTVTSTDKDEEVL 177

  Fly   288 RSYFIKDGKTLQLSD--KYSLKDSVHNDHNRT--TLIVREVTDSDLGEYLCQVENAIGSNEVKVH 348
            ...:.:||.|:..:|  ||.||  |..|....  |:.:|:.|..|.|.|.|:......|..|.::
 Worm   178 DVVWTRDGNTINFNDTEKYILK--VKRDAGVVIETMRIRKATMEDDGNYACEHSQQKASQIVHIN 240

  Fly   349  348
             Worm   241  240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 8/42 (19%)
IGc2 83..146 CDD:197706 8/42 (19%)
IG_like 176..254 CDD:214653 13/77 (17%)
Ig 176..239 CDD:299845 10/62 (16%)
I-set 258..349 CDD:254352 25/105 (24%)
Ig 275..348 CDD:143165 21/80 (26%)
zig-8NP_499714.1 IG_like 55..134 CDD:214653 19/110 (17%)
Ig 55..129 CDD:143165 18/105 (17%)
ig 158..229 CDD:278476 20/72 (28%)
IG_like 158..227 CDD:214653 19/70 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.