| Sequence 1: | NP_001286718.1 | Gene: | CG13506 / 37556 | FlyBaseID: | FBgn0034723 | Length: | 503 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_598259.2 | Gene: | Il1rl2 / 171106 | RGDID: | 621782 | Length: | 561 | Species: | Rattus norvegicus |
| Alignment Length: | 347 | Identity: | 70/347 - (20%) |
|---|---|---|---|
| Similarity: | 128/347 - (36%) | Gaps: | 86/347 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 102 VVWYKNRIIIANGQNPIS--QRVQCMLNNS-ILLRNVSPEDSDDYYCEILPQRVRQHTALRVGAR 163
Fly 164 LSIL----CD---DRDITDRSQTFRQ----GDHHKLECRTYLPDNA---TIKWSFNDLNGQPSSV 214
Fly 215 DNQNGV-IILDNVDEKNAGDYQCLA----------------------DDGSR-----HPPHGTVH 251
Fly 252 IDVQYSPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQ--LSDKYSLKDSVHNDH 314
Fly 315 NRTTLIVREVTDSDLGE-YLCQVENAIGSNEVKVHVSYNPETPQFEDMTVEGNKVTLHWLVRSHQ 378
Fly 379 LLSEAMLDYQLTGSYTWSTVQV 400 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG13506 | NP_001286718.1 | IG_like | 79..146 | CDD:214653 | 12/46 (26%) |
| IGc2 | 83..146 | CDD:197706 | 12/46 (26%) | ||
| IG_like | 176..254 | CDD:214653 | 21/112 (19%) | ||
| Ig | 176..239 | CDD:299845 | 18/92 (20%) | ||
| I-set | 258..349 | CDD:254352 | 21/93 (23%) | ||
| Ig | 275..348 | CDD:143165 | 16/75 (21%) | ||
| Il1rl2 | NP_598259.2 | Ig | 26..115 | CDD:416386 | 17/67 (25%) |
| Ig strand A' | 31..35 | CDD:409353 | |||
| Ig strand B | 39..44 | CDD:409353 | |||
| Ig strand C | 55..59 | CDD:409353 | 0/2 (0%) | ||
| Ig strand C' | 64..66 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 74..78 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 80..84 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 93..101 | CDD:409353 | 3/7 (43%) | ||
| Ig strand G | 104..115 | CDD:409353 | 2/10 (20%) | ||
| Ig | 133..222 | CDD:416386 | 17/88 (19%) | ||
| Ig strand A | 135..140 | CDD:409353 | 1/4 (25%) | ||
| Ig strand B | 145..149 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 161..166 | CDD:409353 | 3/4 (75%) | ||
| Ig strand C' | 169..171 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 176..180 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 182..187 | CDD:409353 | 0/4 (0%) | ||
| Ig strand F | 196..205 | CDD:409353 | 3/8 (38%) | ||
| Ig strand G | 208..221 | CDD:409353 | 0/12 (0%) | ||
| Ig | 230..330 | CDD:416386 | 22/113 (19%) | ||
| Ig strand A | 230..233 | CDD:409353 | 0/2 (0%) | ||
| Ig strand A' | 238..241 | CDD:409353 | 0/2 (0%) | ||
| Ig strand B | 246..255 | CDD:409353 | 3/11 (27%) | ||
| Ig strand C | 262..268 | CDD:409353 | 2/6 (33%) | ||
| Ig strand C' | 270..273 | CDD:409353 | 0/2 (0%) | ||
| Ig strand E | 296..303 | CDD:409353 | 0/6 (0%) | ||
| Ig strand G | 322..330 | CDD:409353 | 0/7 (0%) | ||
| TIR | 389..539 | CDD:396246 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 0 | 0.000 | |||||