DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and Il18r1

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_032391.1 Gene:Il18r1 / 16182 MGIID:105383 Length:537 Species:Mus musculus


Alignment Length:272 Identity:59/272 - (21%)
Similarity:94/272 - (34%) Gaps:65/272 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 VSPEDSDDYYCEILPQRVRQHTALRVGARLSILC-DDRDITDRSQTFRQGDHHKLECR------- 191
            |..||...|..::  ...|::..|.|..|....| .|:.:|.|.....:..|  :.|:       
Mouse    89 VEMEDEGTYISQV--GNDRRNWTLNV
TKRNKHSCFSDKLVTSRDVEVNKSLH--ITCKNPNYEEL 149

  Fly   192 ---TYLPDNATIKWSFNDLNGQPSSVDNQNGVIILDNVDEKNAGDYQCLAD---DGSRHPPHGTV 250
               |:|..|.      .:::..|.         ||.:.:..:.|.|.|:..   :|:|:....||
Mouse   150 IQDTWLYKNC------KEISKTPR---------ILKDAEFGDEGYYSCVFSVHHNGTRYNITKTV 199

  Fly   251 HIDV-----QYSP-IVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGKTLQLSDKYSLKDS 309
            :|.|     :.:| |:......|..|.|...||.|:.........|:     :::..|  |...:
Mouse   200 NITVIEGRSKVTPAILGPKCEKVGVELGKDVELNCSASLNKDDLFYW-----SIRKED--SSDPN
 257

  Fly   310 VHNDHNRTTLIVRE-------------VTDSDLGE-YLCQV--ENAIGSNEVKVHVSYNPETPQF 358
            |..|...||..:.|             :|::.|.. |.|.|  |.||   :.|..|....|.|..
Mouse   258 VQEDRKETTTWISEGKLHASKILRFQKITENYLNVLYNCTVANEEAI---DTKSFVLVRKEIPDI 319

  Fly   359 EDMTVEGNKVTL 370
            ......|....|
Mouse   320 PGHVFTGGVTVL 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 4/10 (40%)
IGc2 83..146 CDD:197706 4/10 (40%)
IG_like 176..254 CDD:214653 17/90 (19%)
Ig 176..239 CDD:299845 12/72 (17%)
I-set 258..349 CDD:254352 25/107 (23%)
Ig 275..348 CDD:143165 20/88 (23%)
Il18r1NP_032391.1 IG_like 26..112 CDD:214653 6/24 (25%)
Ig 131..205 CDD:386229 17/90 (19%)
PHA02785 <157..257 CDD:165149 24/121 (20%)
TIR 374..534 CDD:366714
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.