DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and IGSF5

DIOPT Version :9

Sequence 1:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:XP_011527774.1 Gene:IGSF5 / 150084 HGNCID:5952 Length:497 Species:Homo sapiens


Alignment Length:178 Identity:40/178 - (22%)
Similarity:70/178 - (39%) Gaps:36/178 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 GDDVILNCD-ARNFQLSNAVVWYKNRIII--ANGQNPI-------SQRVQCMLN--NSILLRNVS 136
            |.....||. ::.::|   ::|..:.:::  .....||       |||.....|  :.:::.||.
Human   143 GSQARFNCTVSQGWKL---IMWALSDMVVLSVRPMEPIITNDRFTSQRYDQGGNFTSEMIIHNVE 204

  Fly   137 PEDSDDYYCEILPQRVRQHTALRVGARLSI-LCDDRDITDRSQTFRQGDHHKLECR----TYLPD 196
            |.||.:..|.:      |::.|...|.|:: :..:..|...:....:.:..::.|.    |.|||
Human   205 PSDSGNIRCSL------QNSRLHGSAYLTVQV
MGELFIPSVNLVVAENEPCEVTCLPSHWTRLPD 263

  Fly   197 NATIKWSFNDLNGQ------PSSVDNQNGVIILDNVDEKNAGDYQCLA 238
               |.|....|...      |...|.|:.|.||....:.| |...|:|
Human   264 ---ISWELGLLVSHSSYYFVPEPSDLQSAVSILALTPQSN-GTLTCVA 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 16/73 (22%)
IGc2 83..146 CDD:197706 16/73 (22%)
IG_like 176..254 CDD:214653 18/73 (25%)
Ig 176..239 CDD:299845 18/73 (25%)
I-set 258..349 CDD:254352
Ig 275..348 CDD:143165
IGSF5XP_011527774.1 IG_like 135..228 CDD:214653 21/93 (23%)
Ig <200..230 CDD:299845 10/35 (29%)
Ig 236..307 CDD:299845 18/74 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143423
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.