Sequence 1: | NP_001286718.1 | Gene: | CG13506 / 37556 | FlyBaseID: | FBgn0034723 | Length: | 503 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001343407.1 | Gene: | Il1rl2 / 107527 | MGIID: | 1913107 | Length: | 574 | Species: | Mus musculus |
Alignment Length: | 274 | Identity: | 58/274 - (21%) |
---|---|---|---|
Similarity: | 100/274 - (36%) | Gaps: | 73/274 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 102 VVWYKNRIIIANGQNPISQRVQCMLNNS---ILLRNVSPEDSDDYYCEILPQRVRQHTALRVGAR 163
Fly 164 LSIL----CD---DRDITDRSQTFRQ----GDHHKLECRTYLPDNA---TIKW--SFNDLNG--- 209
Fly 210 -QPSSVDNQNGVIILDNVDEKNAGDYQCLA----------------------DDGSR-----HPP 246
Fly 247 HGTVHIDVQYSPIVSTHRHNVN-TEKGATAELYCNYRAKPIGRSYFIKDGKTLQ--LSDKYSLKD 308
Fly 309 SVHNDHNRTTLIVR 322 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13506 | NP_001286718.1 | IG_like | 79..146 | CDD:214653 | 11/46 (24%) |
IGc2 | 83..146 | CDD:197706 | 11/46 (24%) | ||
IG_like | 176..254 | CDD:214653 | 20/117 (17%) | ||
Ig | 176..239 | CDD:299845 | 17/97 (18%) | ||
I-set | 258..349 | CDD:254352 | 20/68 (29%) | ||
Ig | 275..348 | CDD:143165 | 14/50 (28%) | ||
Il1rl2 | NP_001343407.1 | Ig | 25..115 | CDD:416386 | 15/67 (22%) |
Ig strand A' | 31..35 | CDD:409353 | |||
Ig strand B | 39..44 | CDD:409353 | |||
Ig strand C | 55..59 | CDD:409353 | 0/2 (0%) | ||
Ig strand C' | 64..66 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 74..78 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 80..84 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 93..101 | CDD:409353 | 3/11 (27%) | ||
Ig strand G | 104..115 | CDD:409353 | 1/10 (10%) | ||
Ig | 135..222 | CDD:416386 | 17/91 (19%) | ||
Ig strand A | 135..140 | CDD:409353 | 1/4 (25%) | ||
Ig strand B | 145..149 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 161..166 | CDD:409353 | 3/4 (75%) | ||
Ig strand C' | 169..171 | CDD:409353 | 0/1 (0%) | ||
Ig strand D | 176..180 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 182..187 | CDD:409353 | 0/9 (0%) | ||
Ig strand F | 196..205 | CDD:409353 | 3/8 (38%) | ||
Ig strand G | 208..221 | CDD:409353 | 0/12 (0%) | ||
Ig | 230..332 | CDD:416386 | 21/86 (24%) | ||
Ig strand A | 230..233 | CDD:409353 | 0/2 (0%) | ||
Ig strand A' | 238..241 | CDD:409353 | 0/2 (0%) | ||
Ig strand B | 246..255 | CDD:409353 | 4/8 (50%) | ||
Ig strand C | 262..268 | CDD:409353 | 2/6 (33%) | ||
Ig strand C' | 270..273 | CDD:409353 | 0/2 (0%) | ||
Ig strand G | 322..332 | CDD:409353 | |||
TIR | 389..539 | CDD:396246 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |