DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13506 and CEACAM5

DIOPT Version :10

Sequence 1:NP_611666.2 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster
Sequence 2:NP_004354.3 Gene:CEACAM5 / 1048 HGNCID:1817 Length:702 Species:Homo sapiens


Alignment Length:395 Identity:90/395 - (22%)
Similarity:163/395 - (41%) Gaps:60/395 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YGDDTDDDDTQIIDVTKNHAEQEAPPYFDVTDLRVEAKPGDDVILNCDARNFQLSNAV-VWYKNR 108
            :..||..:.|.:..:|   ...|.|..|..::.....:..|.|.|.|:.   ::.|.. :|:.| 
Human   302 HNSDTGLNRTTVTTIT---VYAEPPKPFITSNNSNPVEDEDAVALTCEP---EIQNTTYLWWVN- 359

  Fly   109 IIIANGQNPISQRVQCMLNN-SILLRNVSPEDSDDYYCEILPQRVRQHTALRVGARLSILC--DD 170
                |...|:|.|:|...:| ::.|.:|:..|...|.|.|..:....|:...:   |::|.  ||
Human   360 ----NQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVI---LNVLYGPDD 417

  Fly   171 RDITDRSQTFRQGDHHKLECRTYLPDNATIKWSFNDLNGQPSSVDNQNGVIILDNVDEKNAGDYQ 235
            ..|:.....:|.|.:..|.|.......|...|..:      .::......:.:.|:.|||:|.|.
Human   418 PTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLID------GNIQQHTQELFISNITEKNSGLYT 476

  Fly   236 CLADD---GSRHPPHGTVHIDVQY-SPIVSTHRHNVNTEKGATAELYCNYRAKPIGRSYFIKDGK 296
            |.|::   |.......|:.:..:. .|.:|::......:|.|.| ..|...|:.....::: :|:
Human   477 CQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVA-FTCEPEAQNTTYLWWV-NGQ 539

  Fly   297 TLQLSDKYSLKDSVHNDHNRTTLIVREVTDSDLGEYLCQVENAIGSNE---VKVHVSYNPETPQF 358
            :|.:|.:..|.:.     || ||.:..||.:|...|:|.::|::.:|.   |.:.|.|.|:||..
Human   540 SLPVSPRLQLSNG-----NR-TLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPII 598

  Fly   359 ---EDMTVEGNKVTL------------HWLV----RSH-QLLSEAMLDYQLTGSYTWSTVQVLET 403
               :...:.|..:.|            .|.:    :.| |:|..|.:.....|:|. ..|..|.|
Human   599 SPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYA-CFVSNLAT 662

  Fly   404 HRHNN 408
            .|:|:
Human   663 GRNNS 667

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13506NP_611666.2 Ig_3 69..146 CDD:464046 19/78 (24%)
Ig_3 173..238 CDD:464046 14/64 (22%)
Ig 258..349 CDD:472250 23/93 (25%)
Ig strand B 275..279 CDD:409353 1/3 (33%)
Ig strand C 288..292 CDD:409353 0/3 (0%)
Ig strand E 317..321 CDD:409353 2/3 (67%)
Ig strand F 331..336 CDD:409353 2/4 (50%)
CEACAM5NP_004354.3 IgV_CEACAM_D1 36..140 CDD:409430
FR1 37..55 CDD:409430
Ig strand A 37..39 CDD:409430
Ig strand A' 44..46 CDD:409430
Ig strand B 49..56 CDD:409430
CDR1 56..63 CDD:409430
FR2 64..69 CDD:409430
Ig strand C 64..68 CDD:409430
CDR2 70..91 CDD:409430
Ig strand C' 78..83 CDD:409430
Ig strand C' 88..91 CDD:409430
FR3 98..124 CDD:409430
Ig strand D 98..103 CDD:409430
Ig strand E 105..109 CDD:409430
Ig strand F 119..124 CDD:409430
CDR3 125..132 CDD:409430
FR4 133..140 CDD:409430
Ig strand G 133..139 CDD:409430
IgI_hCEACAM_2_4_6_like 146..234 CDD:409402
Ig strand A 146..150 CDD:409402
Ig strand A' 153..158 CDD:409402
Ig strand B 163..169 CDD:409402
Ig strand C 176..181 CDD:409402
Ig strand C' 183..186 CDD:409402
Ig strand D 190..194 CDD:409402
Ig strand E 197..202 CDD:409402
Ig strand F 212..220 CDD:409402
Ig strand G 224..233 CDD:409402
IgC2_CEACAM5-like 243..318 CDD:409540 4/18 (22%)
Ig strand A 243..249 CDD:409540
Ig strand B 254..261 CDD:409540
Ig strand C 267..273 CDD:409540
Ig strand C' 276..281 CDD:409540
Ig strand E 284..290 CDD:409540
Ig strand F 293..304 CDD:409540 0/1 (0%)
Ig strand G 307..318 CDD:409540 2/13 (15%)
IgI_hCEACAM_2_4_6_like 324..412 CDD:409402 22/98 (22%)
Ig strand A 324..328 CDD:409402 1/3 (33%)
Ig strand A' 331..336 CDD:409402 0/4 (0%)
Ig strand B 341..347 CDD:409402 3/5 (60%)
Ig strand C 354..359 CDD:409402 1/4 (25%)
Ig strand C' 361..364 CDD:409402 0/2 (0%)
Ig strand D 368..372 CDD:409402 2/3 (67%)
Ig strand E 375..380 CDD:409402 1/4 (25%)
Ig strand F 390..398 CDD:409402 3/7 (43%)
Ig strand G 402..411 CDD:409402 2/11 (18%)
IgC2_CEACAM5-like 421..496 CDD:409540 16/80 (20%)
Ig strand A 421..427 CDD:409540 0/5 (0%)
Ig strand B 432..439 CDD:409540 2/6 (33%)
Ig strand C 445..451 CDD:409540 2/5 (40%)
Ig strand C' 454..459 CDD:409540 0/4 (0%)
Ig strand E 462..468 CDD:409540 1/5 (20%)
Ig strand F 471..482 CDD:409540 5/10 (50%)
Ig strand G 485..496 CDD:409540 2/10 (20%)
IgI_hCEACAM_2_4_6_like 502..590 CDD:409402 23/95 (24%)
Ig strand A 502..506 CDD:409402 1/3 (33%)
Ig strand A' 509..514 CDD:409402 0/4 (0%)
Ig strand B 519..525 CDD:409402 2/6 (33%)
Ig strand C 532..537 CDD:409402 0/5 (0%)
Ig strand C' 539..542 CDD:409402 0/2 (0%)
Ig strand D 546..550 CDD:409402 0/3 (0%)
Ig strand E 553..558 CDD:409402 4/5 (80%)
Ig strand F 568..576 CDD:409402 2/7 (29%)
Ig strand G 580..589 CDD:409402 2/8 (25%)
IgC2_CEACAM5-like 599..674 CDD:409540 14/70 (20%)
Ig strand A 599..605 CDD:409540 0/5 (0%)
Ig strand B 610..617 CDD:409540 1/6 (17%)
Ig strand C 623..629 CDD:409540 1/5 (20%)
Ig strand C' 632..637 CDD:409540 0/4 (0%)
Ig strand E 640..646 CDD:409540 2/5 (40%)
Ig strand F 649..660 CDD:409540 3/11 (27%)
Ig strand G 663..674 CDD:409540 2/5 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.